KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0865Help
Entry
SPH_0865          CDS       T00658                                 

Definition
(GenBank) superoxide dismutase [Mn] (General stress protein 24)(GSP24)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Brite
Enzymes [BR:spv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPH_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
804148..804753
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagaacttccatatgcatacgacgctttggaaccatacatcgat
gcggaaacaatgcatttgcaccatgacaaacaccatcaaacttatgtcaacaatgccaat
gcagctttagaaaaacaccctgaaatcggtgaagaccttgaagccttgcttgctgatgta
gaatctatcccagctgatatccgtcaagcacttatcaacaatggtggcggacacttgaac
cacgctcttttctgggaattgatgactcccgagaaaacagctccttcagcagaactggca
gcagcaatcgatgcaacatttggttcatttgaagaatttcaagcagccttcactgcagca
gcaacaactcgttttggttcaggttgggcatggttggttgtcaacaaagaagggaaactt
gaagtgacttcaacagcaaaccaagacacaccaatctcagaaggtaaaaaaccaatcttg
ggcttggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaagctttcttttcagtaatcaactggaataaagtagatgaattgtacgcagctgct
aaataa

DBGET integrated database retrieval system