KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1601Help
Entry
SPH_1601          CDS       T00658                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Brite
Translation factors [BR:spv03012]
 Eukaryotic Type
  Elongation factors
   SPH_1601 (tuf)
 Prokaryotic Type
   SPH_1601 (tuf)
Mitochondrial biogenesis [BR:spv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SPH_1601 (tuf)
Exosome [BR:spv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPH_1601 (tuf)
  Exosomal proteins of breast cancer cells
   SPH_1601 (tuf)
  Exosomal proteins of colorectal cancer cells
   SPH_1601 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: ACA35953
UniProt: B1ICR4
LinkDB All DBs
Position
complement(1477912..1479108)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactaccctaactgcagctatcacaactgttttggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcactatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactac
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
caaatggacggagctatccttgtagtagcttcaactgacggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggttgacgacgaagaattgcttgaattggttgaaatggaaatccgtgaccta
ttgtcagaatacgacttcccaggtgacgatcttccagttatccaaggttcagcacttaaa
gctcttgaaggtgactctaaatacgaagacatcgttatggaattgatgaacacagttgat
gagtatatcccagaaccagaacgtgacactgacaaaccattgcttcttccagtcgaggac
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtatcgtt
aaagtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactcaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgctggagataacgtaggt
gtccttcttcgtggtgttcaacgtgatgaaatcgaacgtggacaagttatcgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtctacatccttactaaagaagaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtactact
gacgttacaggttcaatcgaacttccagcaggtactgaaatggtaatgcctggtgataac
gtgacaatcgacgttgagttgattcacccaatcgccgtagaacaaggtactacattctct
atccgtgagggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system