KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0944Help
Entry
SPG_0944          CDS       T00734                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPG_0944 (tdk)
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPG_0944 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
908951..909541
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggtaagacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacttcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttctcaaacgccaccatgtttacgacctagctcgt
gttgtagacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcggacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system