KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1595Help
Entry
SPG_1595          CDS       T00734                                 

Gene name
nanB
Definition
(GenBank) neuraminidase B
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPG_1595 (nanB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPG_1595 (nanB)
Enzymes [BR:spx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPG_1595 (nanB)
Bacterial toxins [BR:spx02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPG_1595 (nanB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1537369..1539462)
Genome map
AA seq 697 aa AA seqDB search
MNKRGLYSKLGISVVGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISSL
LLDKLSGESQTVVMKFKADEPNSLQALFGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQ
KGINYLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNI
NGIDKATLGAVNREGKEHYLAKGSIDEISLFNKAISDQEVSNIPLSNPFQLIFQSGDSTQ
ANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFND
YEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADS
GFKEINGHYYLKLKKNGDNDFRYTVRENGVVYDETTNKPTNYTINDKYEVLEGGKSLTVE
QYSVDFDSGSLRERHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPF
LGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATA
EAQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQ
LIDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELP
NHHIGVLFEKYDSWSRNELHLSNVXQYIDLEINDLTK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaggtctttattcaaaactaggaatttctgttgtaggcattagtctttta
atgggagttcccactttgattcatgcgaatgaattaaactatggtcaactgtccatatct
cctatttttcaaggaggttcatatcaactgaacaataagagtatagatatcagctctttg
ttattagataaattgtctggagagagtcagacagtagtaatgaaatttaaagcagatgaa
ccaaactctcttcaagctttgtttggcctatctaatagtaaagcaggctttaaaaataat
tacttttcaattttcatgagagattctggtgagataggtgtagaaataagagacgcccaa
aagggaataaattatttattttctagaccagcttcattatggggaaagcataaaggacag
gcagttgaaaatacactagtatttgtatctgattctaaagataaaacatacacaatgtat
gttaatggaatagaagtgttctctgaaacagttgatacatttttgccaatttcaaatata
aatggtatagataaggcaacactaggagctgttaatcgtgaaggtaaggaacattacctc
gcaaaaggaagtattgatgaaatcagtctatttaacaaagcaattagtgatcaggaagtt
tcaaatattcccttgtcaaatccatttcagttaattttccaatcaggagattctactcaa
gctaactattttagaataccgacactatatacattaagtagtggaagagttctatcaagt
attgatgcacgttatggtgggactcatgattctaaaagtaagattaatattgccacttct
tatagtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagtttaatgac
tatgaggagcagttagtttactggccacgagataataaattaaagaatagtcaaattagt
ggaagtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaaacgata
ttactagctgatgttatgcctgcgggtattggaaataataatgcaaataaagccgactca
ggttttaaagaaataaatggtcattattatttaaaactaaagaagaatggagataacgat
ttccgttatacagttagagaaaatggtgtcgtttatgatgaaacaactaataaacctaca
aattatactataaatgataagtatgaagttttggagggaggaaagtctttaacagtcgaa
caatattcggttgattttgatagtggctctttaagagaaaggcataatggaaaacaggtt
cctatgaatgttttctacaaagattcgttatttaaagtgactcctactaattatatagca
atgacaactagtcagaatagaggagagagttgggaacaatttaagttgttgcctccgttc
ttaggagaaaaacataatggaacttacttgtgtcctggacaaggtttagcattaaaatca
agtaacagattgatttttgcaacatatactagtggagaactaacctatctcatttctgat
gatagtggtcaaacatggaagaaatcctcagcttcaattccgtttaaaaatgcaacagca
gaagcacaaatggttgaactgagagatggtgtgattagaacattctttagaaccactaca
ggtaagatagcttatatgactagtagagattctggagaaacatggtcggaagtttcgtat
attgatggaatccaacaaacttcatatggcacacaagtatctgcaattaaatactctcaa
ttaattgatggaaaagaagcagtcattttgagtacaccaaattctagaagtggccgtaag
ggaggtcaattagttgtcggtttagtcaataaagaagatgatagtattgattggaaatac
cactatgatattgatttgccttcgtatggttatgcctattctgcgattacagaattgcca
aatcatcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaattgcat
ttaagcaatgtanttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system