KEGG   Streptococcus pyogenes HSC5: L897_02725Help
Entry
L897_02725        CDS       T02743                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spyh  Streptococcus pyogenes HSC5
Pathway
spyh00620  Pyruvate metabolism
spyh00680  Methane metabolism
spyh01100  Metabolic pathways
spyh01120  Microbial metabolism in diverse environments
spyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spyh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L897_02725
  Energy metabolism
   00680 Methane metabolism
    L897_02725
Enzymes [BR:spyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     L897_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: AGQ27338
LinkDB All DBs
Position
498816..501629
Genome map
AA seq 937 aa AA seqDB search
MVKSGMIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIE
SIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDT
DYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRD
AKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTE
YKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAA
LYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPA
ARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREV
MQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEP
RTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEV
GLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNK
DGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKD
RIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVAD
SNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQ
NRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQ
YAQLAESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNY
IQIELIKRWRNNQLDENDEKLIHTTINGIATGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaaagtggtatgatagaagaaactagcaaagaaggagatggtcatttgccactt
aaaaagttagagagtagtaacaatcaagctatcattgctgaagaagttgctcttttgaaa
gaaatgttggaaaatatcacacgacggatgattggagatgacgcgtttacagttatcgag
tctattatggtgttatctgaaaaacaagattacatagaattagaaaaagttgtcgccaat
atttcaaatcaagaaatggaagtgatttccaggtatttttctattttacccttgctaatc
aatatttcagaagatgtcgatttagcctatgaaattaattatcaaaataatacggatact
gattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagataatggtaaa
gacattttggagcaggttaatgtggttcctgttttaacagcacatccgacgcaagtacaa
cgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaataccgtgat
gctaaggctggtgtgattaatcttgagaaatggcgtcaggagctatatcgttatattgaa
atgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaacgagataaaa
aatgtcatgcagtattacgatggttccctaattcaggctgtgaccaaattgacaacagag
tacaaaaatttagcccaaaaacacggtctagagttagacaatcccaaacccattaccatg
gggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaaaccttgtgc
ttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaattagcagcc
ctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaagtggaacgt
ttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttatcgcagagct
tttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaatcagccagca
gctcgtatgagtagtagtgtgggactaaacacatctgcttggtcctcaccagctagttta
gaaaatcccatcttagcctatgactctcctgttgattttaaagctgatttaaaggctatt
gagcagtcgctacttgataatggcaactccgctttgattgagggggatttgcgagaagtc
atgcaagctgttgatatttttggcttcttcttagcaagcattgacatgaggcaagactcc
agtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgttgacgattat
agctctctttcagaaactgaaaaatgcgatgttctcttacaacaattaatggaggagcca
agaaccttatcctcagcggcagttgctaaatcagacctattagaaaaagaactggctatc
tatactacggcacgagaattgaaagataagcttggagaagaggttattaagcaacatatt
atttcacatacagaaagtgtctctgatatgtttgagttggccatcatgcttaaagaagtg
ggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaaaccattgag
gatttagataatgcccgtgacatcatggcagcctatttaagccatgacattgtcaaatct
tggattgcaacgaatcgtaattaccaagaaatcatgttaggctattctgacagtaataaa
gatggtggctacttggcatcgggttggactctttataaagctcagaatgaattaacggct
attggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggaggaacagttggt
cgaggaggtggcccttcttatgatgccattacttcacaaccttttggttccatcaaagat
cggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaataaagatgtg
gcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtgactcaaatg
ataacagatcctaatgagattgatagttttcgagaaatcatggatagcattgttgctgat
agcaataccatttatcgaaaattggtttttgacaatccccatttctatgattatttcttt
gaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagaccagcagcccgt
aaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttcatggtcacaa
aatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgttatattgac
cgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggccttttttccat
tccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatattgcctttcag
tatgcacaactagctgaaagtcaggatgttcgagatgttttttatgaaattttggatgag
tggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatctattggaggat
aatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtgttgaactat
attcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaatgatgaaaaa
ttgatccatacaactatcaatggcatagcgactggtttacgtaattcaggctaa

DBGET integrated database retrieval system