KEGG   Streptococcus pyogenes STAB901 (serotype M44): STAB901_02795Help
Entry
STAB901_02795     CDS       T03472                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spyo  Streptococcus pyogenes STAB901 (serotype M44)
Pathway
spyo00620  Pyruvate metabolism
spyo00680  Methane metabolism
spyo01100  Metabolic pathways
spyo01120  Microbial metabolism in diverse environments
spyo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spyo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    STAB901_02795
  Energy metabolism
   00680 Methane metabolism
    STAB901_02795
Enzymes [BR:spyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     STAB901_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: AIG50092
LinkDB All DBs
Position
496365..499127
Genome map
AA seq 920 aa AA seqDB search
MPLKKLESSNNQTIIAEEVALLKEMLENITRRMIGDDAFTVIKSIMVLSEKQDYIELEKV
IANISNQEMEVISRYFSILPLLINISEDVDLAYEINHQNNTDTDYLGKLALTIKDLAGKD
NGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGVINLEKWRQELYR
YIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKP
ITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSE
VERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSSSVGLNTSAWSSP
ASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMR
QDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKE
LAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFE
TIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNE
LTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGN
KDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYD
YFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKR
YIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEI
LDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDEN
DEKLIHTTINGIATGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
ttgccacttaaaaagttagagagtagtaacaatcaaactatcattgctgaagaagttgct
cttttgaaagaaatgttggaaaatatcacacgacggatgattggagatgatgcgtttaca
gttatcaagtctattatggtgttatctgaaaaacaagattacatagaattagaaaaagtt
atcgccaatatttcaaatcaagaaatggaagtgatttccaggtatttttctattttaccc
ttgctaatcaatatttcagaagatgtcgatttagcctatgaaattaatcatcaaaataat
acagatactgattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagat
aatggtaaagacattttggagcaggttaatgtggttcctgttttaacagcacatccgacg
caagtgcaacgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaa
taccgtgatgctaaggctggtgtaattaatcttgagaaatggcgtcaggagctatatcgt
tatattgaaatgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaac
gagataaaaaatgtcatgcagtattacgatggttccctaattcaggctgtgaccaagttg
acaacagagtacaaaaatttagcccaaaaacacggtctagagttagacaatcccaaaccc
attaccatggggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaa
accttgtgcttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaa
ttagcagccctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaa
gtggaacgtttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttat
cgcagagcttttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaat
cagccagcagctcgtatgagtagtagtgtgggactaaacacatctgcttggtcctcacca
gctagtttagaaaatcccatcttagcctatgactctcctgttgattttaaagctgatcta
aaggctattgagcagtcgctacttgataatggcaactccgctttgattgagggggatttg
cgagaagtcatgcaagctgttgatatttttggcttcttcttagcaagcattgacatgagg
caagactccagtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgtt
gacgattatagctctctttcagaaactgaaaaatgcgatgttctcttacaacaattaatg
gaggagccaagaaccttatcctcagcggcagttgctaaatcagacctattagaaaaagaa
ctggctatctatactacggcacgagaattgaaagataagcttggagaagaggttattaag
caacatattatttcacatacagaaagtgtctctgatatgtttgagttggccatcatgctt
aaagaagtgggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaa
accattgaggatttagataatgcccgtgacatcatggcagcctatttaagccatgacatt
gtcaaatcttggattgcaacgaatcgtaattaccaagaaatcatgttaggttattctgac
agtaataaagatggtggctacttggcatcgggttggactctttataaagctcagaatgaa
ttaacggctattggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggagga
acagttggtcgaggaggtggcccttcttatgatgccattacttcacaaccttttggttcc
atcaaagatcggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaat
aaagatgtggcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtg
actcaaatgataacagatcctaatgagattgatagttttcgagaaatcatggatagcatt
gttgctgatagcaataccatttatcgaaaattggtttttgacaatccccatttctatgat
tatttctttgaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagacca
gcagcccgtaaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttca
tggtcacaaaatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgt
tatattgaccgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggcct
tttttccattccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatatt
gcctttcagtatgcacaactagctgaaagtcaggatgttcgagatgttttttatgagatt
ttggatgagtggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatcta
ttggaggataatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtg
ttgaactatattcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaat
gatgaaaaattgatccatacaactattaatggcatagcgactggtttacgtaattcaggc
taa

DBGET integrated database retrieval system