KEGG   Serratia sp. AS13: SerAS13_2152Help
Entry
SerAS13_2152      CDS       T02012                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sra  Serratia sp. AS13
Brite
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SerAS13_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEG27935
LinkDB All DBs
Position
2311699..2312223
Genome map
AA seq 174 aa AA seqDB search
MKHYWYAAFGLMACGVAQAATVDVDMNLVTGQGIGQEIGKVTISETPYGLLFTPQLKALP
AGVHGFHVHENGSCEPGMKEGKAVAALAAGGHFDPQKTGKHLGPYADGHLGDLPAIYVTA
DGMSTDPVLAPRLKKISEITGKALMVHAGGDNHSDHPKPLGGGGERFACGVIKG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattggtatgcggccttcggcctgatggcctgtggcgtcgcccaggcggca
acggtggatgttgacatgaatctggtgaccggacagggaattggccaggagattggcaaa
gtcacgatcagcgaaacgccttacggcctgctgtttacccctcagttaaaagcgttgccg
gccggagtgcacggctttcacgtgcatgagaacggcagttgcgagccgggaatgaaagag
ggtaaggcggtagcagcgttggcggcgggtgggcattttgatccgcaaaaaaccggcaag
caccttggcccttacgcagacggccatttgggcgatctgccggctatttacgttacggca
gacggcatgtccacggatccggtgctggctccacggctgaaaaaaatcagcgaaataacc
ggcaaagcgctcatggtacatgccggcggcgacaaccactccgatcatccgaaacccttg
ggtggcggaggggaacgttttgcctgcggtgtgattaaagggtaa

DBGET integrated database retrieval system