KEGG   Serratia sp. AS13: SerAS13_2737Help
Entry
SerAS13_2737      CDS       T02012                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sra  Serratia sp. AS13
Pathway
sra00240  Pyrimidine metabolism
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SerAS13_2737
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SerAS13_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: AEG28514
LinkDB All DBs
Position
complement(2935061..2935645)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSILYAMIAQEHQQQPVHCVLLDESQFLTKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDESGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIHALE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattattctgctatgaatgcaggaaaatccaccgcactgtta
caatcttcatataattatcaagaacgtggtatgcgcacgttggtgtttactgccgaaatc
gatcatcgttttggcgtagggaaggtgagttcgcgcataggcttgtcgtcccaggcgcag
ctctataataatgactccatactctatgccatgattgctcaggaacatcagcagcagccg
gtacactgcgtgttattggatgaaagccaatttttgacgaaagcacaggttgagcaattg
tgcgacgtagtcgatcaactggatattccggtattgtgctatgggttgcgtaccgacttt
ctgggtgagctgtttatcggcagccaatatttgctggcttgggcggataaactggtggag
ttgaaaactatctgccactgcggccgcaaggcgaatatggtgctgaggttggatgaaagc
ggccaggcaatgcatgcaggtgaacaggtcgtgataggcggcaacgagagctatgtgtcc
gtttgccgcaaacattacaaggaagccatacacgcactggagtga

DBGET integrated database retrieval system