KEGG   Salinibacter ruber M8: SRM_01313Help
Entry
SRM_01313         CDS       T01209                                 

Gene name
ddl
Definition
(GenBank) D-ala D-ala ligase C-terminus superfamily
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srm  Salinibacter ruber M8
Pathway
srm00473  D-Alanine metabolism
srm00550  Peptidoglycan biosynthesis
srm01100  Metabolic pathways
srm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SRM_01313 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SRM_01313 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SRM_01313 (ddl)
Enzymes [BR:srm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SRM_01313 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:srm01011]
 Precursor biosynthesis
  Amino acid ligase
   SRM_01313 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CBH24234
UniProt: D5H879
LinkDB All DBs
Position
complement(1484707..1485708)
Genome map
AA seq 333 aa AA seqDB search
MRIGLLYDTFDAYSWANDDPPDADAEYEPIETVDTLAAAVEHLGHTPVRVGTAADLRDRL
GGGLSLDAAINITEGAHSRNREAYVPILLEMAGVPCLGSDALTLSVTLDKAWTKDLVAAA
DIPTPPHRVYSAPEAVDADDLPGAFPLFVKPRYEGTSKGITPDSKVEDVAALRGAVDRIT
TTYDQDAVAEPFVAGGGEFTVAVVGHDPPEALPVLQRGVEPTTGLGLHVLEHRGAPTADR
DWEYELRGTLAPALEDRLQALSRRAFDTLDCRDFARADFRVDGDGTPWFLEINPLPTFKP
DDTFAIVAELMGRDYVDYLAEVFGRGLRRLGLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcctcctctacgacaccttcgacgcctattcgtgggccaacgacgacccg
ccggacgccgacgccgagtacgagcccatagagacggtcgacaccctcgcggccgccgtg
gagcacctcgggcacacccccgtccgcgtcgggaccgcggccgacctgcgcgaccggctc
ggggggggactgtcgctcgacgccgcgatcaacatcacggagggggcccacagccgcaac
cgggaggcctacgtcccgattctgctggagatggccggcgtcccttgcctcggctccgac
gcgctcaccctctcggtgacgctggacaaggcctggacgaaagacctcgtcgcggccgcc
gacatccccaccccgccgcatcgggtctacagcgcgcccgaagccgtcgacgccgacgac
cttccgggcgcgtttcccctgttcgtgaagccacgctacgaagggacgtcgaagggcatc
acgcccgacagcaaggtggaggacgttgcggccctgcggggcgcggtggaccgcatcacg
acgacgtacgaccaggacgccgtggcggagcccttcgtggcgggcggcggcgagtttacg
gtggccgtcgtggggcacgacccgcccgaggcgctgcccgttctccagcgcggggtggag
cccacgaccggcctcggcctgcacgtcctggagcaccgcggcgcccccactgccgatcgg
gactgggaatacgaattgcggggcacgctcgcccccgccctcgaagaccgcctgcaggcc
ctcagccgcagggccttcgacacgctcgactgccgcgacttcgcccgcgcggacttccgg
gtggacggcgacggaaccccctggtttctcgaaatcaacccgctgccgacgttcaaaccc
gacgataccttcgcgatcgtcgccgagctcatgggccgtgactacgtggactacctcgcc
gaggtgttcgggcgggggctgcggcgactgggactctcgtaa

DBGET integrated database retrieval system