KEGG   Streptosporangium roseum: Sros_1503Help
Entry
Sros_1503         CDS       T01137                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00052  Galactose metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
Module
sro_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_1503
   00052 Galactose metabolism
    Sros_1503
Enzymes [BR:sro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sros_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACZ84496
UniProt: D2AQF2
LinkDB All DBs
Position
1587477..1588430
Genome map
AA seq 317 aa AA seqDB search
MNFGTTPSGEKVERHVLAAGRMRASVLGYGAILQSLEVSGVNVVLGCDTLEDYLTRSRYF
GAVVGRYGNRIAGGRFTLDGVTHRLPVNNGPNSLHGGPGGFSSRVWRVAEVSGTAVTLEY
VSADGEEGYPGTLTVSLTYTLTEDALRLDYRATTDAPTVLNLTNHSYFNLAGSGDVLKHV
VRIDADRYLPVDSSQIPTGELAPVAGTPFDFTTPHEIGARIADPRLGGGYDHCYVLRGGI
EVVEPAGGRVMEVSTTEPGVQFYSGNLLDGVATAYGRHAGLCLETQHFPDSPNREHFPST
VLRPGEEFASTTVYRFP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttcggaaccaccccgtcgggggagaaggtcgagcggcacgtgctggccgccggg
cggatgcgcgcctcggtgctcggctacggcgcgatcctgcagtccctggaggtctccggg
gtcaacgtggtgctcggctgcgacaccctggaggactacctgacgcgcagccgctacttc
ggcgcggtcgtcggcaggtacggcaaccgcatcgcgggcgggcggttcaccctcgacggc
gtcacccacaggctgccggtgaacaacgggcccaacagcctgcacggcgggccgggcggg
ttctccagtcgcgtgtggcgggtggcggaggtctccggcacggcggtgacgctggagtac
gtcagcgccgacggggaggagggctacccgggcaccctgaccgtctcgctcacctacacg
ctgaccgaggacgcgctccggctggactaccgcgcgaccaccgacgcgccgaccgtgctc
aacctgaccaaccactcctacttcaacctcgccgggagcggcgacgtcctcaagcacgtt
gtccgcatcgacgccgaccgctacctgccggtggactcctcgcagatcccgaccggggag
ctcgccccggtggcgggcaccccgttcgacttcacgacgccccacgagatcggcgcgcgg
atcgcggacccgcggctgggcggcggctacgaccactgctacgtcctgcgcggcggcatc
gaggtcgtcgaaccggccggcggccgcgtcatggaggtctccaccaccgagccgggcgtc
cagttctactcgggcaacctcctggacggcgtcgccaccgcgtacggcaggcacgccggg
ctctgcctggagacccagcacttccccgactcgcccaaccgggagcacttcccgtccacg
gtgctgcgccccggcgaggagttcgcctccacgaccgtctaccggttcccctga

DBGET integrated database retrieval system