KEGG   Streptococcus suis ST1: SSUST1_0992Help
Entry
SSUST1_0992       CDS       T02125                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
srp  Streptococcus suis ST1
Pathway
srp00240  Pyrimidine metabolism
srp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSUST1_0992 (tdk)
Enzymes [BR:srp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SSUST1_0992 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AER21367
UniProt: G7SL50
LinkDB All DBs
Position
complement(989250..989831)
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRRDAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKELP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaattatattataaatatgggacaatgaactcaggaaaaaccattgagattttg
aaggttgcccacaactatgaagaacaaggaaaacctgttgttatcatgacatctgcactt
gatactcgtgatgcctttggtgttgtatccagtcgtataggcatgagaagagatgcagtg
gcgattgacgatgatatggatatctttggttttattgaaaaaatggaaccgcgtccttac
tgtgttctcattgatgaagcacaatttcttcgacgtcatcatgtctacgcactcgctcgc
gtagtcgatgaattagatgtacccgttatggctttcggtcttaaaaatgatttccgaaat
gaactgtttgaaggttcccaacatttgctcttattggctgataaattagatgaaatcaaa
acaatctgccaatattgttctaaaaaagcgacaatggttttgagaacacaggatggaaaa
cctacctatgaaggagaacaaatccaaattggtggcaatgaaacctacattcctgtctgt
cgcaaacattatttttcaccagaaattaaagaattaccctaa

DBGET integrated database retrieval system