KEGG   Serratia sp. AS12: SerAS12_4878Help
Entry
SerAS12_4878      CDS       T01502                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srs  Serratia sp. AS12
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SerAS12_4878
  Energy metabolism
   00680 Methane metabolism
    SerAS12_4878
Enzymes [BR:srs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SerAS12_4878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
5280332..5282968
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDKKLSTKE
LQNAVSQLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYSLPAEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
LAGGDEVQEPYREIMKQLRGQLMRSQAYLEGRLKGERVLKPNDLLVSNDQLWEPLFACYQ
SLQACGMGIIANGQLLDTLRRVRCFGVPLVRIDVRQESNRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVAISSLALYAGAVLEANLLPPPEPKKEWRSLMDDLS
ETSCKMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQNQLEAMCRDWPFFSTRIAMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLESDIKVVLTIANDAHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDTRVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaattgctcggc
gataccatcaaagatgcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgccggtaacgaggcgcaccgtcaggagctgctttccaccttg
cagaacctgtccaacgacgagttgctgccggtcgcgcgcgccttcagccagttccttaat
ctgaccaacgtcgccgagcagtaccacagcatttcgcccaatggcgaagccgccagcaat
cccgaagcgctggcccaactgttcacccggctgaaagacaaaaagctcagcaccaaagag
ctgcaaaatgcggtctctcagctctccatcgagctggtgctgactgcgcacccgacggaa
atcacccgccgcaccctgatccacaagctggttgaggtcaacacctgtctgagccaactc
gatcataacgatctggccgattacgagcgcaacaagatcatgcgccgcctgcgccagttg
gttgcccagtcatggcacaccgacgagatccgtaaaaaccgcccttcacctatcgacgaa
gccaagtggggctttgcggtggtggaaaacagcctgtgggaaggggtgcctgccttcctg
cgcgaattcaacgagcagttggaaaactccatcgattacagcctgccggcggaagccgtg
ccggttcgcttcacctcctggatgggcggtgaccgcgacggtaacccgaacgtgaccgcc
gaaattacccgtcatgtgctgctgctcagccgctggaaagcctgcgacctgttcacccgc
gatatccaggtgttggtgtccgagctgtcgatgaccgaatgtaccccggaattgcgtgcc
ctcgccggtggcgacgaagtgcaggaaccgtaccgcgaaatcatgaaacagctgcgcggc
cagttgatgcgttctcaggcctatctggaaggccgcctgaagggcgaacgcgtgctgaag
ccgaacgacctgctggtaagcaacgatcagctgtgggaacctttgttcgcctgttatcag
tcgctgcaggcctgcggcatgggcatcattgccaacggtcagttgctggataccctgcgc
cgtgtccgttgctttggcgtgccgctggtgcgtatcgacgtccgtcaggaaagcaaccgc
cataccgaagccatcgccgaactgacccgttatctgggcctcggcgactacgaaagctgg
tcagaagccgacaaacaggcattcctgatccgcgaactgaactccaaacgcccgctggtg
ccgctgaagtgggaaccgagcgccgacacccaggaagtgctggaaacctgccgcgtgatc
gccgaagcgccgcaaggctccatcgccgcctacgtcatctccatggcacgcaccccttct
gacgtgctggcggtccatctgctgctgaaagaagccggttgcccgtttgcgctgccggta
gcgccgctgttcgaaaccctcgacgacctgaacaacgccgacgacgttatgacccagttg
ctgaatatcgactggtatcgcggctttatccagggcaagcagatggtgatgatcggctat
tccgactcggcgaaagacgccggggtgatggccgcttcctgggcgcagtaccgcgcgcaa
gatgccttgatcaaaacttgtgaaaaggccggagtggcgttaacgctgttccacggccgt
ggcggttcgattggccgcggcggtgcgcctgcacatgcggcgctgctgtcgcagccgccg
ggcagcctgaaaggtggcctgcgcgtgaccgaacagggtgagatgattcgcttcaaattt
ggcctgccggaagtggccatcagcagcctggcgctgtatgccggcgcggttctcgaagcc
aacctgctgccgccgccggagccgaagaaagagtggcgttcgctgatggacgacctgtca
gagacatcatgcaaaatgtaccgcggctacgtgcgcgagaatccggacttcgtgccttac
ttccgcgccgcaacaccggagctggaactgggtaaactgccgctgggttcacgcccggcc
aagcgcaagccaaacggcggcgtagaaagcctgcgcgccattccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccggcctggctcggcgccggcgcaggtttgcaggaagcg
gtgaaagctggcaaacagaatcagttggaagccatgtgccgcgactggccgttcttctcc
acccgcatcgccatgctggaaatggtcttcgccaaggccgacctgtggcttgcggaatac
tacgatcagcgcctggtcgacaaatcgctgtggccactgggtcagcagttgcgcgatcag
ctcgaaagcgacatcaaggttgtgttgaccattgccaatgacgctcacctgatggaagac
ctgccgtggatcgccgaatccatcgcgctgcgcaacgtgtataccgatccgctgaacgtg
ctgcaggcagagctgctgcaccgctcccgccagcaggaacatcctgatacccgcgttgaa
caggcattgatggtcaccattgccggcgtcgccgccggcatgcgcaacaccggctag

DBGET integrated database retrieval system