KEGG   Streptomyces reticuli: TUE45_02825Help
Entry
TUE45_02825       CDS       T04246                                 

Gene name
nedA_1
Definition
(GenBank) Sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
srw  Streptomyces reticuli
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TUE45_02825 (nedA_1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TUE45_02825 (nedA_1)
Enzymes [BR:srw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TUE45_02825 (nedA_1)
Bacterial toxins [BR:srw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TUE45_02825 (nedA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(3284622..3285698)
Genome map
AA seq 358 aa AA seqDB search
MTDVTVPFRAGREGYASFRIPAVVAGRSGTLLAFCEGRVDSAADHGHIHIVLKRSTDGGR
TWGPLQVAARNGTDLAGNPAPVVLDTGRILLVHVRAAASATEAAVLRGQVAEADGRRVWV
QHSDDDGLTWSAPREITAQVKRPGWRWYATTPGHALQLTTGRVLVPANHTVAPAGTDTGA
EAKYHGGHCLLSDDRGATWRLGYLDDDTDGYVNVNETTAAELPDGRVYLNARNDSPSPGN
RADAHSPDGGETLTKPFRPQAGLTAPVCEAAVLQLRDPDVLLFSAPADPGGARALMTIRA
SDDGGTTWHPAFTVDGLPAAYSDLVRVDPHTVGLLYETGDFGAYETITFRRVPVHRLA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgaccgtccccttccgcgcgggccgcgagggctacgcgagcttccgcata
cccgccgtcgtcgccggccggtccggcaccctgctcgccttctgcgagggccgcgtcgac
tccgccgccgaccacgggcacatccacatcgtgctgaagcggtccacggacggcggccgt
acctgggggccgctccaggtcgccgcgcgcaacggcacggacctcgccggcaaccccgcc
cccgtcgtcctggacaccggccggatcctgctcgtgcacgtccgggccgccgcctccgcc
accgaggccgccgtcctgcgcggccaggtcgcggaagccgacgggcggcgggtgtgggtg
cagcacagcgacgacgacggactgacgtggtccgcgcccagggagatcaccgcgcaggtg
aagcggcccggctggcgctggtacgccaccacccccggccacgccctccagctcaccacc
ggccgcgtcctcgtcccggccaaccacaccgtggcgcccgccggcaccgacaccggcgcc
gaggcgaagtaccacggcgggcactgcctgctcagcgacgaccgcggcgcgacctggcgc
ctcggctacctggacgacgacaccgacggctacgtcaacgtcaacgagaccaccgccgcc
gaactccccgacggccgcgtctacctcaacgcccgcaacgactccccgtcgcccggcaac
cgcgccgacgcccactcgccggacggcggcgagacgctcacgaagcccttccgcccgcag
gccggactgaccgcgccggtctgcgaggccgccgtgctccagctccgcgaccccgacgtg
ctgctcttctccgccccggccgaccccggcggcgcccgcgccctgatgacgatccgcgcc
tccgacgacggcggcaccacctggcacccggcgttcaccgtcgacgggctgcccgccgcc
tactccgacctggtccgcgtcgacccgcacaccgtcggactgctgtacgagacgggcgac
ttcggcgcctacgagacgatcaccttccgccgggtgcccgtgcaccggctggcctga

DBGET integrated database retrieval system