KEGG   Streptomyces reticuli: TUE45_04527Help
Entry
TUE45_04527       CDS       T04246                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srw  Streptomyces reticuli
Pathway
srw00620  Pyruvate metabolism
srw00680  Methane metabolism
srw01100  Metabolic pathways
srw01120  Microbial metabolism in diverse environments
srw01200  Carbon metabolism
Module
srw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TUE45_04527 (ppc)
  Energy metabolism
   00680 Methane metabolism
    TUE45_04527 (ppc)
Enzymes [BR:srw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TUE45_04527 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CUW29816
UniProt: A0A0U5LRV2
LinkDB All DBs
Position
I:5135185..5137917
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANITEQVHRGRELRAKRAAEGGLLSRTADRLKDADPEHL
RQTVQNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVLDSDRRRHDVRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHADAVGDVLEDLTAELERVGVKLPDDTRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGLLSNSIRYTGATDELLDSL
KADLDLLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEDGRDYLGTSELL
KDLRIIQASLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPRDYRAKLLAKELRSRRPLAPTPAPVDAAGQKTLGVFETVKKALDVFGPE
VIESYIISMCQGADDVFAATVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
HQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDDLKHVFDTIKAEHELTVREVLRVT
GEEELLDAQPVLKQTFAIRDAYLDPISYLQVALLKRQREAAAAGVSPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgaccagcagcgagctgcgtgccgacatccgc
cggctgggtgatctcctcggggagaccctcgtccggcaggaaggcccggaactcctcgaa
ctggtcgagaaggtccgccgcctcacccgcgaggacggcgaggccgccgccgagctgctg
cgcggcaccgagctggagaccgcggccaagctggtccgcgcgttctccacctacttccac
cttgccaacatcaccgaacaggtgcaccgcggccgggaactgcgcgccaagcgcgccgcc
gagggcggactgctctcgcgcaccgccgaccggctcaaggacgccgaccccgagcacctg
aggcagaccgtccagaacctcaacgtgcggccggtcttcaccgcccaccccaccgaggcc
gcacgccggtccgtcctcaacaagctccggcgcatcgccgcactcctggacacccccgtc
ctcgactccgaccgccgccgccacgacgtccgcctcgccgagaacatcgacctcgtctgg
cagaccgacgagctgcgcgtcgtccggcccgagcccgccgacgaggcccgcaacgccatc
tactacctcgacgaactccacgccgacgcggtcggagacgtcctggaggacctcaccgcc
gaactggagcgcgtcggcgtcaagctgcccgacgacacccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtc
ctcatcctccagcacgaacacggcatcaacgacgccctggagatgatcgacgagctgcgc
ggactgctctccaactccatccgctacaccggcgccaccgacgagctgctggactccctc
aaggccgacctcgacctgctccccgagatcagcccccgctacaagcggctcaacgccgag
gagccctaccggctcaaggccacctgcatccggcagaagctggagaacaccaagcagcgc
ctcgccaagggcaccccgcacgaggacggccgcgactacctcggcaccagcgagctgctg
aaggacctccggatcatccaggcctccctgcgcgaacaccgcggcggcctgttcgccgac
ggccgcctggcccgcaccatccgcaccctggccgccttcggcctccagctcgccaccatg
gacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctc
ggcgaggaatcctggcgctacgccgacatgccccgcgactaccgggccaagctcctcgcc
aaggaactgcgctccagaaggccgctcgcccccaccccggcccccgtggacgcggccggg
cagaagaccctcggcgtcttcgagaccgtcaagaaggccctggacgtcttcggccccgag
gtcatcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccacc
gtgctcgcccgcgaggccggcctcatcgacctgcacgccggctgggcgaagatcggcatc
gtccccctcctggagaccaccgacgagctgaaggccgccgacaccatcctggaggacatg
ctctccgacccgtcctaccggcgcctggtcgcgctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcggcggctgcgcgacgtcgcccaccgctacggcgtccggctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgaggtcatctcc
gacaagtacctcatcccctccctcgcccgggagaacctggaactgaccgtcgccgccacc
ctccaggcctccgccctgcacaccgccccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggacgtcgtctccgacgccgcccacgccgcctaccggcgcctcgtcgag
gacccggacctgccgacgtacttcctcgcgtcgacgccggtggaccagctcgccgacctg
cacctgggctcccgcccctcccgccgccccggctccggcgtctcgctcgacggcctgcgc
gccatcccgtgggtgttcggctggacccagtcccgccagatcgtccccggctggttcggc
gtcggctccggcctcaaggccctgcgcgaagccggcctggacaccgtgctggacgagatg
caccagcagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgccaag
acggacctgcggatcgcccagcactacgtcgacaccctcgtccccgacgacctcaagcac
gtcttcgacaccatcaaggccgaacacgagctgaccgtccgcgaggtcctgcgcgtcacc
ggcgaagaggaactgctggacgcccagcccgtcctcaagcagaccttcgccatccgcgac
gcctacctggaccccatctcctacctccaggtcgccctgctcaagcggcagcgcgaggcg
gcggcggccggcgtcagccccgaccccctgctctcccgcgccctgctcctcaccgtcaac
ggcgtggcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system