KEGG   Streptomyces reticuli: TUE45_07256Help
Entry
TUE45_07256       CDS       T04246                                 

Definition
(GenBank) Putative DNA ligase-like protein/MT0965
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(8222293..8223354)
Genome map
AA seq 353 aa AA seqDB search
MPPVKPMLAKSVAKIPPGMHYEAKWDGFRSIVFRDGAEVELGSRTGKPLTRYFPELAEAL
KERLPERCVLDGEIVIARGGRLDFDALTERIHPAASRVRMLAEKTPASFVAFDLLALDDH
ALLDVPLTDRRALLDRALAAATPPVHVAPSTTDIEVARQWFEQFEGAGLDGVVAKPLTLH
YLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDEQGRLQHVGVSAAFAMKK
RAELVAELEPLRMDDVSGHPWAAWADEAAHETARLPGAPSRWSGKKDLSWVPLRPERVAE
VAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGEKHRG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatcccgcccgggatgcac
tacgaggcgaagtgggacggcttccggtcgatcgtgttccgggacggggccgaggtcgag
ctgggcagccgtaccggaaagccgctgaccaggtactttcccgagctggccgaggcactg
aaggagcggctgcccgagcggtgcgtgctggacggggagatcgtgatcgcgcggggcggc
cggctggacttcgacgcgctgaccgagcggatccacccggcggcctcccgggtgcggatg
ctggccgagaagaccccggcctccttcgtcgccttcgacctgctcgccctggacgaccac
gccctgctcgacgtcccgctgaccgaccgccgcgccctgctggaccgggccctcgccgcg
gcgaccccgccggtgcacgtggcgccctccacgaccgacatcgaggtggcccggcagtgg
ttcgagcagttcgagggcgccggtctggacggggtcgtggccaagccgctcaccctgcac
tacctccaggacgagcgggccatgttcaagatcaagcacgagcggacggcggacgtcgtc
gtcgccgggtaccgcttccacaagagcggcccggtggtgggctcgctgctgctgggtctg
tacgacgagcagggccggctccagcacgtgggcgtgtcggccgcgttcgccatgaagaag
cgcgccgaactggtcgcggagctggagccgctgcgcatggacgacgtgtccgggcacccg
tgggctgcctgggcggacgaggccgcgcacgagacggcccggctgccgggcgcgccgagc
cgctggtcgggcaagaaggacctgtcctgggtgccgctgcggccggagcgggtggccgag
gtggcgtacgaccacatggagaacgggcagcggttccggcacacggcccgcttccgccgc
tggcgcccggaccgtacgccggagagctgcacctacgcccagttggaggagccggtgcgc
tacgacctggcggagatcctcggcgagaagcaccgcggctga

DBGET integrated database retrieval system