KEGG   Sinocyclocheilus rhinocerous: 107726487Help
Entry
107726487         CDS       T04916                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial isoform X1
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:srx00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    107726487
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    107726487
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107726487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MLCRVGYVRRCAATLNPILGAVASRQKHTLPDLPYDYGALEPHICAEIMQLHHSKHHATY
VNNLNVTEEKYQEALAKGDVTTQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPQGELL
EAIKRDFGSFQKMKDKISAATVAVQGSGWGWLGFDKDSGRLRIAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYVKAIWNVVNWENISERLQAAKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcagggtcggatatgtccgcaggtgtgctgccaccttgaaccccatcttgggt
gctgtggcctccagacagaagcacacactgcctgacctcccatatgactatggtgcactt
gagcctcacatctgtgctgagattatgcagcttcaccacagcaagcaccatgcaacatat
gtcaacaacctcaatgtcactgaggagaaatatcaagaggcactggccaagggtgatgtg
acaactcaagtctcccttcagcctgctttgaaatttaacggtggtggccatattaatcat
accatattctggacaaatctgtcaccaaatggtggaggagaaccacagggtgagctgttg
gaagccattaagcgtgactttggctcatttcagaagatgaaggacaagatatcagctgcc
acagtggccgttcagggctcaggatggggctggctgggctttgataaggacagtggaaga
ctgaggattgctgcatgtgcgaatcaagaccctttgcagggcactacaggtctcatccca
ctacttgggatagatgtctgggagcatgcatactatctccagtacaagaatgttagaccg
gactatgttaaggccatctggaatgttgtgaactgggagaatatcagcgagcgtttacaa
gctgcgaagaaataa

DBGET integrated database retrieval system