KEGG   Serratia rubidaea: AXX16_1109Help
Entry
AXX16_1109        CDS       T04417                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srz  Serratia rubidaea
Pathway
srz00250  Alanine, aspartate and glutamate metabolism
srz00410  beta-Alanine metabolism
srz00640  Propanoate metabolism
srz00650  Butanoate metabolism
srz01100  Metabolic pathways
srz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AXX16_1109
   00650 Butanoate metabolism
    AXX16_1109
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXX16_1109
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXX16_1109
Enzymes [BR:srz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AXX16_1109
Amino acid related enzymes [BR:srz01007]
 Aminotransferase (transaminase)
  Class III
   AXX16_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AML56831
UniProt: A0A126VEU0
LinkDB All DBs
Position
1192880..1194145
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQQATPRGVGVMCGFYAERAENATLWDVEGNQVIDFAAGIAVLNTGHRHPK
VLAAIEQQLQAFTHTAYQIVPYESYVSLAERINQRAPIDGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGIITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALHGVSTQ
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFIQALRTLCDEHGILLVADEV
QTGFARTGKLFAMEHYDSKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIDEEQLCQRAQRLGHHLVEVLQQARASCPAIAEIRAQGSMVAVEFND
PASGQPSAEFTRQVQQKALQEGLLLLSCGVHGNVIRFLYPLTIPEEQFTKALGILSRALA
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaaccaacgtcgtcagcaagccacgccacgcggggtgggagtt
atgtgtggtttttacgcagagcgggcggaaaacgccaccctgtgggatgtggaaggcaat
caagttatcgattttgcggccggcatcgcggtgctgaacaccggtcaccgtcatccgaaa
gtgctggcggcgattgaacaacagctgcaggcctttacccataccgcctaccagatcgtg
ccgtatgaaagctacgtctcactggccgagcgcatcaaccagcgcgcgccgatcgacggg
ccgtgtaagaccgccttcttcaccaccggcgccgaagcggtcgaaaacgcggtgaaaatc
gcccgcgctcataccggccgtccgggcattatcacctttggcggcggcttccacggccgc
acctatatgaccatggcgctgaccggcaaagtggcgccgtacaaactgggcttcgggccg
ttccccggctcggtgttccacggccagtacccgaacgcgctgcacggcgtcagcacgcag
gacgcgatgaacagcctggagcgcatcttcaaggcggatatcgacccgaaacaggtggcg
gcgatcgtgctggagccggtgcagggcgagggcggctttaacgttgcgccggcggaattt
atccaggcgctgcgcacgctgtgcgatgagcacggcatcctgctggtggcggacgaagta
caaaccggctttgcccgtaccggcaagctgttcgccatggagcattacgacagcaaaccc
gatctgatcaccatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctatgccggtaac
ccgctggcggtggccgcggcgcatgcggtcatggacgtgattgatgaagagcagctgtgc
cagcgcgcgcagcgtctgggccatcatctggtggaggtgctgcagcaggcgcgcgccagc
tgtccggccatcgccgagatccgcgcgcaggggtcgatggtggcggtcgagtttaacgac
cccgccagcgggcagccgtcggcggaattcacccgtcaggtacagcaaaaagccctgcag
gaaggcctgctgctgctgagctgcggcgtacacggcaacgtgatccgcttcctgtacccg
ctgaccattcctgaagaacaattcaccaaggcgctgggcattctttcccgcgcgttggct
gaataa

DBGET integrated database retrieval system