KEGG   Streptococcus sanguinis: SSA_0691Help
Entry
SSA_0691          CDS       T00473                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00473  D-Alanine metabolism
ssa00550  Peptidoglycan biosynthesis
ssa01100  Metabolic pathways
ssa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSA_0691 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSA_0691 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SSA_0691 (ddl)
Enzymes [BR:ssa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSA_0691 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ssa01011]
 Precursor biosynthesis
  Amino acid ligase
   SSA_0691 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK HupH_C DUF5088
Motif
Other DBs
NCBI-GeneID: 4807138
NCBI-ProteinID: YP_001034678
UniProt: A3CLS3
LinkDB All DBs
Position
675373..676434
Genome map
AA seq 353 aa AA seqDB search
MIGKIMAKQRLILLYGGRSAEREVSVLSAESVMRAVNYDRFSVKTYFITKDGDFIQTQEF
EAKPAADEKLMTNATVDMSQKIKPSDIYEDGAVVFPVLHGPMGEDGSIQGFLEVLKMPYV
GCNILSSGLAMDKITTKRVLESAGIAQVPYVALVDGEDLEQKIQEIEEKLTYPVFTKPSN
MGSSVGISKSENQAELRASLDLAFKYDSRVLVEQGVTAREIEVGLLGNVDVKSTLPGEVV
KDVAFYDYEAKYIDNKITMDIPAKIPEEVVSLMRQNAEAAFRALGGLGLSRCDFFYAEDG
QVFLNELNTMPGFTQWSMYPLLWENMGLSYPDLIEKLVGLAEEAFAKREAHLL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaaaatcatggcaaaacaaagattgattttattgtatggcggacgcagtgca
gagcgggaagtttcggttttatcagctgagagcgtcatgcgggctgtcaattatgataga
ttctcggtgaagacttacttcatcaccaaggatggagattttatccaaactcaggaattt
gaagcaaagccggcggctgatgagaagttgatgaccaatgccacagttgatatgtctcag
aagatcaagcccagcgatatttacgaagatggagcagtggtctttccagttctgcatggt
cccatgggtgaagatggttctattcaaggcttcctagaagtactcaaaatgccttatgtc
ggctgtaatattttatcttctggcttggccatggataaaatcacgaccaagcgagtgctg
gaatcggcaggcattgcccaagtgccttatgtggcgctggtcgatggcgaggatctagag
caaaaaatccaggaaatcgaggagaaattgacctatccagtcttcaccaaaccttccaat
atgggctccagtgtcggcatttctaaatcggagaaccaagcagaactgcgtgcttctctg
gacctggctttcaaatatgacagccgggtactggttgagcagggagtaacggctcgcgag
attgaggttgggcttctgggcaatgttgacgtcaagagtaccctgcctggagaagtggtc
aaggacgtggctttctatgactacgaagccaaatacattgataataaaattaccatggat
attccggccaagattccagaagaagtggtgagcctgatgcgtcaaaatgcagaggcagct
ttccgagctctgggcggtctggggctgtcccgttgtgatttcttctatgcagaagatggt
caggtcttccttaatgagctcaataccatgccaggttttacccagtggtccatgtatcca
ctactctgggaaaatatggggctgtcctatcctgacttgattgagaaactagttggccta
gctgaagaggcatttgctaagagagaggcgcatcttctctaa

DBGET integrated database retrieval system