KEGG   Streptococcus sanguinis: SSA_0721Help
Entry
SSA_0721          CDS       T00473                                 

Gene name
sodA
Definition
(RefSeq) Mn/Fe-dependent superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssa  Streptococcus sanguinis
Brite
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SSA_0721 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
706355..706960
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNVNAALEKHPEIGEDLEKLLADV
ESIPADIRQAVINNGGGHLNHALFWELMTPAETSPSAELAADIEATFGSFEDFKAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKTPILGLDVWEHAYYVKYRNLRPNY
IQAFFSVINWKKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattatcttacctgatcttccttacgcttacgatgctttggagccttacattgat
gaagaaacaatgcacttgcatcatgacaagcaccacaatacctatgtaacgaatgttaat
gctgcgcttgaaaaacatcctgaaatcggtgaggatttggaaaaattattggctgatgtg
gagtctattcctgctgatatccgtcaggcagtcatcaacaacggtggtggtcatcttaac
cacgctcttttctgggaattgatgacaccagcagaaacatcaccatctgcagagttggca
gcggatatcgaagctacttttggatcatttgaagactttaaagcagctttcactgcagcg
gctacaactcgttttggttctggctgggcttggttggttgtcaacaaagaaggcaagttg
gaagtaacttcaacagcaaatcaggatactcctatttcagaaggtaaaactccaatcttg
ggactggatgtttgggaacatgcttactatgtgaaataccgcaatcttcgtccgaactac
atccaagctttcttctcagttattaactggaaaaaggttgacgaactttacgctgctgcg
aaataa

DBGET integrated database retrieval system