KEGG   Streptococcus sanguinis: SSA_1024Help
Entry
SSA_1024          CDS       T00473                                 

Gene name
amy
Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSA_1024 (amy)
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SSA_1024 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1041272..1042738)
Genome map
AA seq 488 aa AA seqDB search
MKRKIYMENQTLMQYFEWYLPDDGQHWNRLAEDAPNLAAKGIRKVWMPPAFKGTGSNDVG
YGVYDLFDLGEFDQKGTVRTKYGLKEEYLRAIEALSQNGIEAIADVVLNHKAAADYKERF
TVVEVDPNNRTKVLSEPFEIKGWTKFVFPGRKKAYNDFEWHWYHFTGTDYDAKNNKSGIF
LIQGDNKGWADDELVDNENGNYDYLMYADIDFKHPEVIQNLYDWAHWFIESTGVHGFRLD
AVKHIDSFFMKNFIRDITEKYGEDFYVFGEFWNSDEKANNDYLENIDYRFDLVDVKLHHN
LFDASKSGADYDLRTIFDQTLAKNHPESAVTFVDNHDTQRGQALESTVEEWFKPAAYALI
LLREAGLPCVFYGDYYGISGEFAQESFQELLDKLLDIRLNLAYGEQTDYFDDANCIGWTR
QGMDDGQPIAVLISNDQATNKSMLVGPEWAGRKFSDYLGNSSQIVTIDDQGWGEFPVEEK
SVSVWSLR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggaaaatttatatggaaaaccaaaccttaatgcagtattttgaatggtatctg
ccagatgacggtcagcattggaatcgcttagcggaagatgcaccaaacttagcagcgaaa
ggaattcgcaaagtctggatgccgccggctttcaagggaacgggctctaatgacgtcggc
tatggtgtttatgacctctttgatttgggagagttcgaccaaaaagggaccgtccgcaca
aagtatggattgaaggaagaatacctccgagcgattgaagcgcttagccaaaacggtatc
gaagctattgcagatgtggttctcaatcacaaggccgcagctgactataaagagcgcttt
accgttgttgaagttgatcctaacaaccgcacaaaggtcttgtcagaacctttcgagatt
aaaggctggactaagtttgtcttcccaggccgcaaaaaagcctacaatgactttgaatgg
cactggtaccacttcaccggcactgactatgatgccaaaaacaacaagtcaggcattttt
ctcatccaaggggacaataaaggttgggcagatgatgagctagtggacaacgagaatggt
aactacgactatctcatgtatgcggatattgatttcaagcaccccgaagtcatccaaaat
ctctacgactgggctcattggtttattgaaagcactggtgtacatggctttcgattagat
gctgtcaagcacatcgattctttctttatgaaaaatttcatccgcgatattactgaaaaa
tacggtgaagatttctatgtttttggggaattttggaatagcgatgagaaggccaataat
gattatctagaaaatattgactaccgctttgacctagtcgatgttaaacttcatcataat
ttatttgatgccagcaaatctggagccgactatgacctacgaactatttttgaccaaaca
cttgcaaagaatcatcctgaatcagctgtgacctttgtagataatcacgatactcagaga
ggtcaggctttggagtctaccgtcgaagaatggttcaagccggcggcctatgctcttata
cttctaagagaagctggattgccttgcgtcttttatggagactactatggcattagcgga
gaatttgcccaagagagctttcaagagctactggataaactcctagacatccgcctcaat
ctagcctatggtgagcagaccgactactttgacgatgccaactgtattggctggactcgc
caaggtatggacgatggtcagccaatcgctgtccttatcagtaatgaccaagcaaccaac
aaatccatgcttgtcggtccagaatgggctggcagaaaattcagtgactatctaggcaac
agctctcaaatcgtaactattgacgaccaaggctggggagaatttcctgtggaggaaaaa
tcagttagtgtctggagtcttagataa

DBGET integrated database retrieval system