KEGG   Spiribacter salinus: SPISAL_01030Help
Entry
SPISAL_01030      CDS       T02685                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssal  Spiribacter salinus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPISAL_01030
  Energy metabolism
   00680 Methane metabolism
    SPISAL_01030
Enzymes [BR:ssal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPISAL_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
210481..213123
Genome map
AA seq 880 aa AA seqDB search
MSENRSDAPLREDIRQLGGLLGSTIHEQAGETVYETIEEVRGLAKDARAGDGAAAEALEK
RLGELPDEMIVPVVRAFSQFLNLANIAEQHHRVRRSRAWVRDPDTGPLRGSLEEFFKRML
PDTEPDDLYNTIAHLDIELVLTAHPTEVMRRSMLQKYNHIAGLLDEGDRVDPTPEEIEEV
HQALKREITAAWETDEIRRRRPAPQDEARWGMAVIEQTLWDVVPHYLRRLDRMLQRQTGK
SLPLNAAPIHFGSWMGGDRDGNPRVTSAVTREVCLLNRWKAVELYEREVGELVEELSLQC
ASDELRDWVGDAWEPYRTALKAVRDRLLATRHWIEARLAGRRPAEGLIYWRADELREPLM
VCYRSLHESGAAVVAEGRLKDLLRRLSVFGLTLMRVDIRQESTRHTEVLDALTQALGIGS
YEAWSEEERQRFLIREIDSRRPLIPRDFEPSDEVAEVLETLRVIAEMGADSLGAYVISMA
SKPSDILAVKLLQKEVGVVSPLRVVPLFETLTDLQGAQTCLEQLLAIPWYRQHIDGFQEV
MIGYSDSAKDASHLTAAWALYQTQEQLVATAREQGIRLILFHGRGGSIGRGGGPTHAAIL
SQPPGSVDGRLRVTEQGEVIQAKFGLRGIAERNLELYTTAVAEATLAPPQPPEANWRALM
DQLAETSCEVYRTLVRETPEFIDYFRHATPEHEISHLAIGSRPARRKPTVGVESLRAIPW
IFAWTQTRLLLPAWLGIGEALRVALENGHEAELQRMYQHWPFFRAFVDMIEMVLAKSDPA
VAAWYDNRLVPEALRPLGAGLRDRHAETRQTVLTVSGHDNPLDEAPVVQRSVGVRNPYVD
PLNLIQVELLDRVRHGHEEDLREALMICINGIAAGMRNTG
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaatcgcagcgatgccccattgcgcgaagatattcggcagctcggtggattg
ctgggtagcaccatccatgagcaggcgggcgagaccgtctacgagacgatcgaggaggtg
cgtgggctcgcgaaagatgcgcgcgcgggcgatggcgcggccgctgaagccctggaaaag
cgcctgggggagcttcccgatgagatgatcgtgccggtggtgcgggcgttctcacaattt
ctgaacctggccaatattgctgagcagcaccaccgggtgcgccgcagccgggcctgggtg
cgtgatccggacaccgggccattgcggggttctctcgaagaattcttcaagcgcatgctg
ccggacactgagccggacgacttgtacaacaccatcgctcaccttgatatcgagctggtg
ctgaccgcgcacccgacagaggtgatgcgccgctcgatgctgcaaaagtacaaccacatt
gcaggactgctcgacgagggcgaccgggtcgatccaacgccagaagagatcgaagaggtg
caccaggccctcaagcgggagatcacggcggcctgggagaccgatgaaatccgccgccgg
cgtccagctccccaggatgaggcacgctggggcatggcggtcatcgagcaaacgctatgg
gatgtggtgccgcactatttgcggcgactcgatcggatgctgcagcgccagacgggtaag
tcattgccgctgaatgccgcgccgattcattttggctcctggatgggcggcgatcgcgac
gggaacccgcgagtcacctcagcggtaacccgtgaggtctgcctgcttaatcgctggaag
gccgttgagctgtatgagcgtgaggtgggtgaactggtcgaggagctctcgctgcagtgc
gcgagcgacgagctgcgcgattgggtgggtgacgcctgggagccctatcggactgcgctc
aaggccgtacgtgaccggctattggccacccgtcactggatcgaggcgcggctcgctggc
cgccgcccggccgaggggctgatctactggcgcgctgatgagcttcgtgaaccgttgatg
gtttgttatcgctcgttgcacgagagcggggccgccgtcgtggccgaaggccgccttaaa
gatctgctacggcgtttgtccgtttttgggctgacgctgatgcgggtggatattcgccag
gaatcgactcgacataccgaggtgctcgacgcgctgacccaggcgcttggcatcggcagc
tacgaggcctggagtgaggaggagcgccaacggttcctgattcgggagattgatagccgc
cggccgttaatccccagggattttgaaccgagcgatgaggtcgccgaggtcctcgaaaca
ctgcgtgtgatcgcggaaatgggcgctgactcgttgggtgcctatgtgatctccatggcc
tcgaagccctccgacatcctggcggtgaagctgctgcaaaaggaagtcggtgtggtctcc
ccgctccgggtagtcccgcttttcgagacgcttaccgatctgcagggtgctcagacctgc
ctggaacagctgctggctatcccttggtaccgccagcatattgatggctttcaggaggtg
atgattggctattctgactccgcgaaggacgccagtcatctgaccgcggcctgggcgctg
tatcagacccaggagcagctcgtggccacggcgcgtgagcagggcatccggctcattctc
ttccacggccgcggtggctctattggtcgaggtggtggcccgacgcatgcggctattctc
tcccagccaccggggtcggtagacgggcgcttgcgggtcactgagcagggcgaggtgatt
caggcgaaattcggcctgcgcggcattgctgagcgtaatcttgagctctacaccaccgcg
gttgccgaggccacgctggcgccgccccagccgcctgaagccaattggcgggcgctcatg
gatcagcttgctgagacctcctgcgaggtctaccgcacactggtccgggagacgccggaa
ttcattgactatttccggcatgccacgccagagcatgagatcagtcacctggccatcggg
agtcggcccgctcggcgcaaacccactgtgggcgtggagagcttgcgcgcgatcccctgg
atttttgcctggacgcagacccggctgttgctgccggcctggctggggattggggaggcg
ctacgggtggcgctggaaaatggccacgaggccgagctccagcggatgtatcagcactgg
ccgttctttcgcgcgttcgtcgacatgattgaaatggtgctcgccaagagtgatccggcg
gtggcagcctggtacgacaaccggctggtccccgaggcgctgcgcccgctgggtgccggt
ctgcgtgatcgtcatgccgagacgcgccaaaccgtgttgacggtgagtggtcatgacaac
cccctggacgaggcaccggtcgtccagcgctcggtgggtgtgcgcaatccctatgtggat
ccactgaacctgattcaggttgagttactggatcgtgtgcgccacggtcatgaggaggat
ctgcgcgaggcgctcatgatctgtatcaatggcattgccgccggcatgcgcaacacggga
taa

DBGET integrated database retrieval system