Sus scrofa (pig): 780435 Help Entry 780435            CDS       T01009                                  Name (RefSeq) glutathione S-transferase mu 2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ssc  Sus scrofa (pig) Pathway ssc00480   Glutathione metabolism ssc00980   Metabolism of xenobiotics by cytochrome P450 ssc00982   Drug metabolism - cytochrome P450 ssc00983   Drug metabolism - other enzymes ssc01100   Metabolic pathways ssc01524   Platinum drug resistance ssc05200   Pathways in cancer ssc05204   Chemical carcinogenesis - DNA adducts ssc05207   Chemical carcinogenesis - receptor activation ssc05208   Chemical carcinogenesis - reactive oxygen species ssc05225   Hepatocellular carcinoma ssc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     780435   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     780435    00982 Drug metabolism - cytochrome P450     780435    00983 Drug metabolism - other enzymes     780435  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     780435    05204 Chemical carcinogenesis - DNA adducts     780435    05207 Chemical carcinogenesis - receptor activation     780435    05208 Chemical carcinogenesis - reactive oxygen species     780435   09162 Cancer: specific types    05225 Hepatocellular carcinoma     780435   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     780435   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     780435  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ssc02000]     780435 Enzymes [BR:ssc01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      780435 Transporters [BR:ssc02000]  Other transporters   Pores ion channels [TC:1]    780435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_C_6 GST_N_3 GST_N_2 GST_C_2 Motif Other DBs NCBI-GeneID:  780435 NCBI-ProteinID:  NP_001072152 UniProt:  Q000H9 LinkDB All DBs Position 4:complement(110451442..110457254) Genome browser AA seq 218 aa AA seqDB search MTMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLSDKFKLGLDFPNL PYLIDGAHKLTQSNAILRYIARKHNMCGETEEEKIRMDILENQAMDVRLQMARICYSPDF EKLKPGYLKEIPEKMKPFSEFLGKRPWFAGDKLTYVDFLAYDVLDLYRIFDPKCLDEFPN LKAFLSRFEGLERISAYMRSSRFLPHPVYSKMAMWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgacgatgatcctcggttactgggacatccgcgggctggcccacgccatccgcctgctc ctggagtacacagactccagctacgaggagaagaagtacacgatgggggacgctcccgac tatgacagaagccagtggctgagtgacaaattcaagctgggcctggacttccccaatctg ccctacttaattgacggggctcacaagctgacccagagcaacgccatcctgcgctacatt gctcgcaagcacaacatgtgtggggagacagaggaggagaagattcgaatggacattttg gagaaccaagctatggatgtccgtttgcagatggccaggatctgctacagccctgacttt gagaaactgaagcctgggtacttgaaggagatccctgaaaagatgaagcccttctccgag tttctggggaagaggccttggtttgcaggggacaagctcacctatgtggatttcctggct tacgatgtccttgacctgtaccgcatattcgatcccaagtgcctggatgaattcccaaac ctgaaagccttcctcagccgctttgagggcctggagaggatctcagcctacatgagatcc agccgcttcctgccacaccccgtgtattcaaagatggccatgtggggcaacaagtag

DBGET integrated database retrieval system