KEGG   Staphylococcus schleiferi 1360-13: LH95_04580Help
Entry
LH95_04580        CDS       T04012                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssch00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH95_04580
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH95_04580
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LH95_04580
Enzymes [BR:ssch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LH95_04580
Peptidoglycan biosynthesis and degradation proteins [BR:ssch01011]
 Precursor biosynthesis
  Amino acid ligase
   LH95_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
974632..975462
Genome map
AA seq 276 aa AA seqDB search
MPEVAPNLEELIDKNNGRNNEIGDNVIDICQTANIVFLGLHGGIGENGKLQAIFDLYNIK
YTGTGYKGSLLAMDKIVSKELMTVNHILTPEWGIMKNENIDTIKAPAVVKPNDNGSSIGV
KVVDDQRELLDAITLAKQYSDTILIEKKIVGREFSVGIIGEKVLPIIELMPKDGFYDYSN
KYQPGATEEITPANISDNQTERMQNIALKVFKKLGLEVYGRVHFIMDSNDNIFCIEANSL
PGMTPTSLLPQEAEAHGINYEQLCEMIVTHSLEKYH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaagttgctccaaatttagaagaattaattgataaaaacaatggtcggaataat
gaaattggagataatgtcattgatatctgtcagactgctaatattgtatttttgggcctt
catggcggtattggtgagaatggtaaattgcaagccatatttgatttatacaatatcaaa
tatacaggcactggatataaaggtagtctattggccatggataaaatagtttcaaaagag
ttaatgactgtcaatcatattttaactcctgagtggggcatcatgaaaaatgaaaatatt
gatactatcaaagcacctgcagttgtaaaacctaatgataacggctcgagtattggagta
aaagttgttgatgatcagcgtgaattattagatgctattacattagctaaacaatattca
gatacaattttaatagaaaagaaaatagtaggaagagaattttctgttggaattataggt
gaaaaagtgttgccaattattgaattaatgcctaaagacggcttttatgattattcaaat
aaatatcaaccaggtgcaacagaagaaattacacctgcaaatataagtgataatcaaaca
gaaagaatgcaaaatattgctttgaaggtatttaaaaagttaggcttagaagtttatggt
agggttcacttcataatggacagtaatgataatattttttgtattgaagcaaattcatta
ccaggtatgacacccacaagtttacttcctcaagaagctgaagcgcatggaatcaattat
gaacaattatgtgaaatgattgttacgcattctctagaaaaatatcattaa

DBGET integrated database retrieval system