KEGG   Shewanella sediminis: Ssed_2057Help
Entry
Ssed_2057         CDS       T00596                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sse  Shewanella sediminis
Brite
Enzymes [BR:sse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Ssed_2057
Peptidases [BR:sse01002]
 Metallo Peptidases
  Family M2
   Ssed_2057
Exosome [BR:sse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ssed_2057
CD molecules [BR:sse04090]
 Proteins
  Ssed_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2491071..2492906)
Genome map
AA seq 611 aa AA seqDB search
MTRLSPKLSKLSFLVALSIGATACNSAQTSDAAAQSKTDEAKQFIQGSEKQLSELSIEIN
RAEWIYSNFITQDTAALSAAVGEKQTATAVKLATMAANYTQLPLDEVSLRKLNILRSSLV
LPAPLDPKKNAELANISAELNGLYGKGKYCFDDGRCLTQPELSAIMAESQNPAELLEVWK
GWREIAKPMRPLFKREVELANEGAKDLGYANLSELWRSQYDMKPDEFSNELDRLWGQVKP
LYDSLHCYVRGELNDEYGDDVVSKDGPIPAHLLGNMWAQSWGNIYAKVAPQDADPGYDVT
ELLAQHNYDELKMVKQAEGFFSSLGFAELPDTFWERSLFVQPKDRDVVCHASAWDLDDLD
DIRIKMCIQKTAEDFTVIHHELGHNYYQRAYKEQPFIFKNSANDGFHEAIGDTIALSITP
SYLKQIGLLDEVPDASKDIGLLLKQALDKVAFMPFGLMIDQWRWKVFSGEITPEQYNQAW
WDLREQYQGVKAPIARGEENFDPGAKYHVPGNVPYTRYFLAHILQFQFHKALCDIAGDKG
PVHRCSIYGNREAGAKLNAMLEMGQSRPWPEALEVVTGSQEMDARAVLDYFAPLQVWLDK
QNSEANRQCGW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttatctccaaagctttcaaagctttcatttctagtcgctctgtctatcggt
gccacggcatgtaacagcgcacaaacctctgatgcagctgctcaatctaagactgatgaa
gccaagcaatttattcagggttcagagaaacaacttagcgaactttctatagaaataaat
cgcgcagagtggatctacagtaacttcattacccaggatacggcagccctttctgctgcc
gtaggtgagaaacagactgccacagctgtaaaactggccaccatggcagccaactatact
cagcttcctctagatgaggtaagtctgcgtaaacttaatattttacgcagctctttggtg
ctaccggcccctctcgatcctaagaaaaatgccgaacttgcaaacataagcgccgagttg
aacggactttacggaaaaggaaagtactgctttgacgatggacgttgtttaactcaaccc
gaactgtcagccatcatggctgaatcacaaaacccggcggagctgctagaagtctggaaa
ggatggcgagaaattgccaaacctatgcgccctctgtttaaacgtgaagtcgagctggca
aatgaaggggcaaaagatcttggctacgccaacctatctgagttatggcgtagtcagtac
gacatgaagcccgacgagttttctaacgaactcgaccgtctatggggacaagttaagcca
ctttatgactcacttcattgttatgttcgtggcgagttaaatgatgagtacggcgatgat
gttgtctcgaaagatggacccatacctgcgcatctgctgggtaatatgtgggcacagagt
tggggtaatatttacgctaaagtcgcgccacaggatgccgatcccggatatgacgttaca
gagcttctcgcacaacataactatgatgaactaaagatggtaaaacaggctgaaggcttc
ttcagctccctgggttttgccgagttacccgacacattctgggaacgttctctgtttgtt
caacctaaagacagagatgtggtctgtcatgcctcagcctgggatctcgatgatttagac
gatatccgcatcaagatgtgtattcaaaaaacggccgaagattttaccgttattcatcac
gaacttggccataactattatcaacgcgcctacaaagagcagccgtttatctttaaaaat
agtgccaatgatggcttccatgaagcgattggtgacaccatcgctctatccatcacccca
agctatcttaaacagataggtttactggacgaagtacccgacgcatcgaaagatatcggc
ctgctacttaaacaggcattagataaagtcgcctttatgccatttggcttgatgatcgac
caatggcgctggaaggtattcagtggtgagatcacgccggaacaatataatcaggcatgg
tgggatctaagggagcaataccaaggcgtgaaggcgccaattgcgcgaggtgaagagaac
tttgatcccggcgctaagtatcatgtgccaggtaacgttccctatactcgctatttctta
gcccatatcctacagttccagttccacaaggcactttgtgacattgccggtgacaagggc
ccggttcatcgttgtagtatctacggcaacagggaagcgggcgctaaacttaacgctatg
ttagagatgggacagagtcgcccatggcctgaagcattggaagtggtcacaggtagtcag
gagatggacgcccgcgccgttctcgattacttcgcgccattacaggtctggttagataag
caaaacagtgaagcgaatcgtcagtgtggttggtag

DBGET integrated database retrieval system