KEGG   Streptococcus suis P1/7: SSU0482Help
Entry
SSU0482           CDS       T00936                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ssi  Streptococcus suis P1/7
Brite
Translation factors [BR:ssi03012]
 Eukaryotic Type
  Elongation factors
   SSU0482 (tufA)
 Prokaryotic Type
   SSU0482 (tufA)
Mitochondrial biogenesis [BR:ssi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SSU0482 (tufA)
Exosome [BR:ssi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SSU0482 (tufA)
  Exosomal proteins of breast cancer cells
   SSU0482 (tufA)
  Exosomal proteins of colorectal cancer cells
   SSU0482 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: CAR45081
LinkDB All DBs
Position
513971..515167
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVISKP
GSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTTDVTGSIKLPEGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtacaattggacac
gttgaccacggtaaaactactttgacagcagctatcacaactgtattggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagagcgc
gagcgcggtatcactatcaacactgcacacgttgagtacgaaactgaaaaacgtcactat
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
cagatggacggtgcgatccttgtagtagcttcaactgacggtccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggttgacgatgaagaattgcttgagttggttgaaatggaaatccgtgacctt
ctttcagaatacgatttcccaggtgatgatcttccagttatccaaggttcagctcttaaa
gctcttgaaggtgactctaagtacgaagacatcgttatggaattgatgaacactgttgat
gagtacattccagaaccagaacgcgacactgacaaaccattgttgcttccagtcgaggac
gtattctcaatcactggtcgtggtactgtagcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtcttcaagaagaaaaatctaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgccggcgataacgttggt
gtgcttcttcgtggtgtacaacgtgatgaaatcgaacgtggtcaagttatctctaaacca
ggttctatcaacccacacactaaattcaaaggtgaagtttacatccttactaaagaagaa
ggtggacgtcacactccattcttcgacaactaccgtccacagttctacttccgtacaact
gacgtaactggttcaatcaaattgccagaaggtactgaaatggtaatgcctggtgataac
gttactatcgacgttgaattgatccacccaatcgccgttgaacaaggtactactttctct
atccgtgaaggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system