KEGG   Sclerotinia sclerotiorum: SS1G_06534Help
Entry
SS1G_06534        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     SS1G_06534
Peptidases [BR:ssl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   SS1G_06534
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SS1G_06534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 271 aa AA seqDB search
MAPILNFALALAMPILSMAAALPSGTELENRGTTLTGTVGIVGGTTAALGEFPYIVSLTY
AGSHFCGGVLLNAYTVLTAAHCSVSYSASSVKVRAGTLTWASGGTQVGVSKVVVHPSYNS
RTIDNDIALWHLSTAIPSSSTIGYAKLPVQGSDPVVGSTATVAGWGLLTENSSSLPATLR
KVSVPVISRSTCQAEYGTSSVTTNMWCAGVTGGGKDSCSGDSGGPIIDAATGVLEGTVSW
GQGCAEAGYAGVYSRVGNYVTYIQSSLWTSL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctccgatcctcaacttcgccctcgcactcgcgatgcccatcctctccatggcagct
gcactccccagcggaaccgaactcgaaaatcgcggcactaccctcacaggcacagtagga
atcgtaggaggaacgaccgccgcattgggagaattcccctacattgttagtttgacatac
gctggatcgcatttctgcggcggtgtattgctcaatgcgtatactgttcttactgctgct
cattgctctgtttcctattcggcatcgtctgttaaagttcgtgctggaactttgacctgg
gcatctggcggtacacaagttggagttagtaaggttgttgttcatccttcttacaactcc
cgaacaatcgataacgatattgcactctggcacttgtcgactgctattccatccagctca
accattggctatgccaagttacccgttcaaggttcggatcctgttgttggttctactgcc
acagttgcaggctggggtcttttgactgagaattcatcctctttaccagcaactttaaga
aaagtctcggttccagtcatctctcgttctacctgccaagctgagtatggtacatcttcc
gttacaaccaacatgtggtgtgcaggagttactggtggtggtaaggactcttgctctggt
gatagtggtggaccaattattgatgctgctactggtgttttggagggaactgtttcctgg
ggtcaaggatgtgctgaagctggttatgctggtgtttactccagagttggtaattatgtt
acttatattcaaagtagcctctggacttccttgtaa

DBGET integrated database retrieval system