KEGG   Streptococcus suis 05ZYH33: SSU05_1539Help
Entry
SSU05_1539        CDS       T00514                                 

Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssu  Streptococcus suis 05ZYH33
Brite
Enzymes [BR:ssu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SSU05_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1471271..1471840)
Genome map
AA seq 189 aa AA seqDB search
MPLEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDVEQIPSDIRQALI
NNGGGHLNHALFWELLSPEKTEISAELAADIDATFGSFDAFKEAFTAAATTRFGSGWAFL
VVNKEGKLEVISTANQDTPIMQGLKPILALDVWEHAYYLNYRNVRPNYIKAFFEVINWDK
VNELYKAAK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggaaccacatattgatgcagaaacaatgacccttcaccacgataagcaccat
gcgacttatgttgcaaatgctaatgcagcacttgaaaaacatcctgaaattggcgaagac
ttggtagctcttttgtcagatgtggagcaaattccttcagacatccgccaagctttgatc
aacaacggtggtggtcatttgaaccatgctcttttctgggaattgctttcacctgaaaaa
acagaaatttcagcagaattggcagcagatattgatgcaacctttggttcatttgatgct
ttcaaagaagccttcactgcagcagcaacaactcgtttcggttcaggttgggctttcttg
gttgttaataaagaaggcaagttggaagttatctcaactgctaaccaagacacaccaatc
atgcaaggtttgaaaccaatcttggcattggacgtttgggaacatgcttactaccttaac
taccgcaatgtccgtccaaactacatcaaagccttctttgaagtaatcaactgggacaag
gttaacgaactttataaagcagctaaataa

DBGET integrated database retrieval system