KEGG   Streptomyces sp. SirexAA-E: SACTE_5371Help
Entry
SACTE_5371        CDS       T01601                                 

Definition
(GenBank) putative neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SACTE_5371
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SACTE_5371
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SACTE_5371
Bacterial toxins [BR:ssx02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SACTE_5371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6071327..6072775)
Genome map
AA seq 482 aa AA seqDB search
MQRRVTVALLSAAVLVATAAGTAHGLPTVAAAAGELASQDIATAGVGSPYYRIPALTTST
KGTLLAAYDARPTLGDLPGNLGVVLRRSTDGGTTWQTQQVVRKEAAPKGFGDPSLLTDTT
TGRIFVFYASSVNQGFFGSATGNDESDPNVLQADYSYSDDDGLTWTHRRITQQIKNPAWA
GMFAASGQGIQLRNGPYKGRLVQQYAIRNNGANYAVSAYSDDHGDTWKMGNPVGPGGDEN
KTVELDDGRIMLNNRSAPYRTIAYSSDGGVNYTPFTQDTNLPDPANNGSVIRYAPDATAS
DPQSSWLLFSNTESTSSRSNLTVKMSCDNGKTWPIRKVVEPGSAAYSTLTRLPDGRVGLL
YERGNVQAITYSSFDLKWLGGTCADITITPPATMKAGTSTEVTVRVVNRMDVTRGAGTLD
LTVPGGWTTKQVAFPATRPGEGANIKVPVTIPAGASGNAELTVTYKADGKQASGTRTVTV
TP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagagtcaccgtcgccctgctgtccgccgccgtcctggtggccaccgcggcc
ggcaccgcccacggcctccccaccgtcgcggccgcggccggcgaactggcctcccaggac
atcgccaccgcgggcgtcggatccccctactaccgcatccccgcgctgaccacctccacc
aagggcaccctgctcgccgcctacgacgcgcgccccacactcggtgacctgccgggcaac
ctcggggtcgtcctgcgccgcagcaccgacggcgggaccacctggcagacccagcaggtc
gtccgcaaggaggccgctcccaagggcttcggcgacccgagtctcctcacggacaccacc
acgggccggatcttcgtcttctacgcgagctccgtgaaccagggcttcttcgggtcggcc
accggcaacgacgagagcgacccgaacgtcctccaggccgactacagctactcggacgac
gacggtctgacctggacccaccgccgtatcacccagcagatcaagaacccggcctgggcc
gggatgttcgccgcctccggccagggcatccagctgcgcaacggcccgtacaagggccgg
ctggtccagcagtacgcgatccggaacaacggggccaactacgcggtgagcgcctacagc
gacgaccacggcgacacctggaagatgggcaaccccgtgggaccgggcggggacgagaac
aagaccgtcgagctcgacgacggacgcatcatgctcaacaaccgctcggcgccctaccgg
acgatcgcctactcctcggacggcggcgtcaactacaccccgttcacccaggacaccaac
ctgcccgacccggcgaacaacggctcggtcatccggtacgccccggacgccaccgcgtcc
gacccgcagtcctcgtggctgctgttcagcaacacggagagcacctcctcgcggagcaac
ctcacggtcaagatgtcctgcgacaacgggaagacgtggccgatccggaaggtcgtcgag
cccggcagcgccgcgtactcgacgctgacacggctgcccgacgggcgggtcgggctgctc
tacgagcgcggcaacgtccaggccatcacctactcctccttcgacctgaagtggctcggc
ggcacctgcgccgacatcacgatcaccccgccggccaccatgaaggccggcaccagcacg
gaggtcacggtccgggtcgtcaaccgcatggacgtgacccgcggcgcgggcacgctcgac
ctgacggtgcccggcggctggacgacgaagcaggtggcgttcccggcgacgcgtccgggt
gagggcgccaacatcaaggtcccggtcacgatcccggccggtgcctccgggaacgccgaa
ctcaccgtgacctacaaggccgacggcaagcaggcctcggggacccggacggtgaccgtg
accccgtaa

DBGET integrated database retrieval system