KEGG   Streptomyces sp. SirexAA-E: SACTE_5876Help
Entry
SACTE_5876        CDS       T01601                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEN13661
UniProt: G2NGC0
LinkDB All DBs
Position
complement(6688135..6689181)
Genome map
AA seq 348 aa AA seqDB search
MPPVKPMLATSVSAIPPGMQYEAKWDGFRAIVHRDGEEVVLGSRTGKPLTRYFPEVVEAV
RENLPPRCVVDGEIVVAHDGRLDFDRLSERIHPADSRVRTLAERTPASLVVFDILALDDA
SLTGRPLTERRAALERAMGGASPPVHLAPATTDEALARRWFEQYEGAGLDGVVAKPLDLT
YRPDVRAMYKVKHERTADCVVAGYRFHKSGPVVGSLLLGLYDAQGALQHVGVSAAFPMKR
RAELVQELEPLRIDPAEHPWAAWADAAAHEGARLPGAPSRWSGKKDMSWVAIAPERVCEV
AYDHMEGDRFRHTARFRRWRPDRAPTSCTYAQLEEVVRYDLSDVLDGG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccgtgaaaccgatgctcgccacgtccgtatccgcgattccgcccggtatgcag
tacgaggcgaagtgggacggcttccgggcgatcgtgcaccgggacggcgaggaggtggtg
ctcggcagccggaccgggaagccgctcacccgctacttccccgaggtggtcgaggcggtg
cgggagaatctgccgccgcgctgtgtggtcgacggggagatcgtggtggcgcacgacggc
cggctggacttcgaccggctgagcgagcgcatccacccggcggactcccgggtgcggacc
ctcgcagagcgcacgccggcctccctggtcgtcttcgacatcctggcgctggacgacgcg
tcgctgaccggccgtccgctgacggagcggcgggcggcgctggagcgggccatgggcggc
gcgtcgccgccggtgcatctggcgcccgccaccaccgacgaggccctggcccggcggtgg
ttcgagcagtacgagggcgccgggctggacggggtggtggccaagccgctggacctgacc
taccgacccgacgtacgggcgatgtacaaggtcaagcacgagcggacggcggactgcgtc
gtggcgggctaccgcttccacaagagcggcccggtggtcggctcgctgctgctggggctg
tacgacgcccagggcgcccttcagcacgtcggggtgagcgcggcgttcccgatgaagcgg
cgtgccgagctcgtccaggagctggaaccgctgcggatcgatcccgccgagcacccgtgg
gcggcctgggcggacgcggcggcccacgaaggggcgcggctgccgggcgcgccgagccgc
tggtccggcaagaaggacatgtcgtgggtggcgatcgccccggagcgggtctgcgaggtg
gcgtacgaccacatggagggcgaccgcttccgccacaccgcccggttccggcgctggcgc
ccggaccgtgcccccaccagctgcacctacgcacagctggaggaggtcgtgcggtacgac
ctgtccgacgtgctcgacggcggctga

DBGET integrated database retrieval system