KEGG   Spirochaeta thermophila DSM 6192: STHERM_c14330Help
Entry
STHERM_c14330     CDS       T01315                                 

Definition
(GenBank) superoxide dismutase Mn type
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Brite
Enzymes [BR:sta01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STHERM_c14330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1560170..1560790
Genome map
AA seq 206 aa AA seqDB search
MSFTLPSLPYPYDALEPHIDARTMEIHHTKHHAGYVNNLNAALEKAPFAKDKDLVFLLRN
LKSLPEEVQTAVRNNGGGHANHSLFWTVLSPEGGGTPQGAVGKAIVSTFGSFDAFKEAFT
KAAATRFGSGWAWLVVNAYGTLQVYSTPNQDSPYLDGFIPILGLDVWEHAYYLSYQNRRP
DYIAAFWNVVNWEEVERRYNETLEAL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacactcccctcacttccctatccctacgatgcactcgagcctcacatagac
gcccggaccatggagatacaccacaccaagcaccatgccgggtacgtgaacaacctcaat
gccgcgctcgaaaaggcgccctttgcaaaggacaaagacctggtctttcttctcaggaat
ctcaagagccttcccgaggaggtgcagaccgcggtccgcaacaacggcggcgggcatgcg
aaccacagcctcttctggaccgtcctctcgcccgaaggcggaggcacgccccagggtgcg
gtcggcaaggccatcgtctcaaccttcggttcgttcgacgccttcaaggaagccttcacc
aaggcggccgccaccagattcgggagcggctgggcctggctcgtggtgaacgcgtatggt
acgctccaggtgtactccacccccaaccaggacagcccctacctggacggcttcatcccc
atcctgggcctggacgtctgggaacacgcctactatctttcgtatcagaacaggaggccc
gactacatcgccgccttctggaacgtggtgaactgggaggaagtcgaacgacgctacaac
gagactctcgaggccctgtga

DBGET integrated database retrieval system