KEGG   Streptococcus pasteurianus: SGPB_0896Help
Entry
SGPB_0896         CDS       T01524                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
stb  Streptococcus pasteurianus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGPB_0896 (tdk)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SGPB_0896 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
933660..934250
Genome map
AA seq 196 aa AA seqDB search
MSLLAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTREGYGVVSSRIGMRR
KAIAITEEMDIFAFIQELPEKPYCVLIDECQFLTKKHVYDLARVVDDLDVPVMAFGLKND
FQNELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTENGKPVYEGNQIQIGGNETYI
PVCRKHYFNPMISKEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacttttggctcaactctattataaatatggaaccatgaattctggaaagaccatt
gagattttgaaagttgctcataactatgaagaacaaggcaaaccagttgttattatgact
tcggcacttgatacgcgtgaaggttatggtgttgtttcaagtcgtattggcatgcgtcgc
aaggcgattgctattacggaagaaatggatatttttgcttttattcaagaattgccagaa
aaaccgtactgtgttttaattgatgaatgtcaatttttaacgaaaaagcatgtctatgat
ttggcgcgtgttgttgatgatttggacgtccctgtgatggcttttgggttaaaaaatgat
tttcaaaatgaattgttcgaaggctccaaatatctactgttattagcagataaaattgat
gaaattaaaaccatttgtcaattttgttctaaaaaagcaaccatggttttgcgaactgaa
aatggcaagcctgtttacgaaggaaatcaaattcaaatcggcggaaacgaaacctatatc
cccgtttgccgtaaacattattttaacccaatgatttccaaagaaaaataa

DBGET integrated database retrieval system