KEGG   Streptococcus thermophilus LMD-9: STER_1701Help
Entry
STER_1701         CDS       T00414                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00473  D-Alanine metabolism
ste01100  Metabolic pathways
ste01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STER_1701
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STER_1701
Enzymes [BR:ste01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     STER_1701
Peptidoglycan biosynthesis and degradation proteins [BR:ste01011]
 Precursor biosynthesis
  Racemase
   STER_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABJ66844
JGI: STER1701
UniProt: Q03IX8
LinkDB All DBs
Position
complement(1591284..1592387)
Genome map
AA seq 367 aa AA seqDB search
MIASLHRPTLAKVDLSAISENIEQVVSHIPKQVQTFAVVKANAYGHGAVEVAKHVSKQVD
GFCVSNLDEALELRQAGIEQPILILGVVLPDGVPLAIQENISLTVASLEWLALAQKQGLD
LIGLTCHIKVDSGMGRIGVRNLKDADNLIAGLKALGADVEGIFTHFATADEADDSKFKRQ
LSFFTDLVDNLTDRPRLVHASNSATSIWHAATVFNTVRLGVVIYGLNPSGSVLELPYNIQ
PALSLETALIHVKTLPAGQDVGYGATYTTTAEEVIGTLPIGYADGWTRDLQGFHVIVDGQ
LCPIVGRVSMDQITVRLPKVYPLGTPVTLMGENGGASITATEVAEKRGTINYEVLCLLSD
RVPRSYD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgagtttacatcgaccaaccttggcaaaggttgatctgtcagcaatttcagaa
aatattgaacaagtggttagtcatattcctaaacaggtgcagacttttgcagttgtaaag
gccaatgcttatggtcatggcgctgttgaagtggctaaacatgtgtctaagcaggtggat
ggtttttgtgtttctaacctagatgaggcgcttgaacttcgtcaagctggcatagagcaa
ccgatacttattttgggagtagtcttgccagatggtgttcccttggctattcaagaaaac
attagtctgacggtggcctcacttgagtggttggcactggctcagaaacaagggcttgat
ttgataggtttgacctgtcatattaaggttgattcaggtatgggtcgtattggggtacgt
aacctaaaggacgcagataacttgattgctggtctgaaggctcttggtgctgatgtcgaa
ggtatttttactcattttgcaacagctgatgaagcagatgatagtaaatttaagcgtcaa
ttatctttcttcaccgatttggtggataacttgactgatagacctcgcttggtgcacgct
agcaactcagcgacaagtatttggcatgcagcaaccgtctttaatacggtacgtctgggt
gttgtcatctatggtctcaatcctagtggcagtgtcttggaacttccctataatattcaa
cctgccctaagtttagagacagctcttattcatgttaagacccttccagccggtcaagac
gtgggttacggtgcaacctatacaactacggctgaagaagttattggaacgcttccgatt
ggctatgcggatggttggactagagatttacaaggtttccatgttattgtggatggacaa
ctttgtcctattgttgggcgtgtgtctatggaccagatcactgttcgccttcctaaggtt
tatccactaggaactccagttacgcttatgggtgaaaatggaggagcgagcattactgcg
acagaggtggctgaaaagcgtggcacaatcaactacgaggtcctttgtttacttagtgat
cgtgtacctcgtagctatgactaa

DBGET integrated database retrieval system