KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0534Help
Entry
MGAS15252_0534    CDS       T01794                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor Tu protein TufA
  KO
K02358  elongation factor Tu
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Brite
Translation factors [BR:stg03012]
 Eukaryotic Type
  Elongation factors
   MGAS15252_0534 (tufA)
 Prokaryotic Type
   MGAS15252_0534 (tufA)
Mitochondrial biogenesis [BR:stg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGAS15252_0534 (tufA)
Exosome [BR:stg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGAS15252_0534 (tufA)
  Exosomal proteins of breast cancer cells
   MGAS15252_0534 (tufA)
  Exosomal proteins of colorectal cancer cells
   MGAS15252_0534 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: AFC65885
LinkDB All DBs
Position
496588..497784
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDTKFEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaatcggacac
gttgaccatggtaaaactactttaacagctgcaatcacaactgtattggcacgtcgcttg
ccttcatcagttaaccaaccaaaagattacgcttctatcgatgctgctccagaagaacgc
gaacgcggaatcactatcaacactgcacacgttgagtacgaaactgcaactcgtcactat
gcgcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgct
caaatggacggagctatccttgtagttgcttcaacagatggaccaatgccacaaacgcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtgttcatgaacaaa
gttgaccttgttgatgacgaagagttgcttgaattagttgagatggaaattcgtgacctt
ctttcagaatacgatttcccaggtgatgaccttcccgttatccaaggttcagctcttaaa
gctcttgaaggcgacactaaatttgaagacatcatcatggaattgatggatactgttgat
tcatacattccagaaccagaacgcgacactgacaaaccattgcttcttccagtcgaagac
gtattctcaattacaggtcgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactaaaaaagctgttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggtcaagttattgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtatatatcctttctaaagacgaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtgacaatcaacgttgagttgatccacccaatcgccgtagaacaaggtactactttctca
attcgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system