KEGG   Streptococcus thermophilus LMG18311: stu0718Help
Entry
stu0718           CDS       T00213                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    stu0718 (ppc)
  Energy metabolism
   00680 Methane metabolism
    stu0718 (ppc)
Enzymes [BR:stl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     stu0718 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
676789..679611
Genome map
AA seq 940 aa AA seqDB search
MAFNKLESSNNQEIISEEVGILKELLDDATRGMAGEQGLTTIQHLVELYDEGDYEALTQA
ISEMTNDDMVVASRYFSLLPLLINISEDVDLAYEVNRKNNIDESYLGKLSETFDVVAESD
NARDILENVNVVPVLTAHPTQVQRKTMLELTNHIHELLRKHRDVKDGLINKDKWYADLRR
YVEIMMKTDIIREKKLKVKNEITNVMEYYNSSLIKAITKLSHEFKRLAVEKGIELDNPTP
ITMGMWIGGDRDGNPFVTAETLKLSATLQSEVILNYYIEKVDNLYRSFSLSSRLTEVSET
VAEMAKLSPDTSVYRENEPYRRAFSYIQSKLIQTLLFFKAGNFSKERAAKRLSENVRLGS
VSTGEVVADFVHDRLSQSLQAVSQQTTEFYETAEAFHDDLLAIKNSLLENDDSVLISGDF
EELLQAVEVFGFYLATIDMRQDSSVHEACVAELLKSANIVDNYSELTEVEKVAVLLKELQ
EDPRTLSSTNVSKSETLEKELAIFRTARLLKDYLGEEVIKQHIISHTESVSDMFELAILL
KEVGLVDTERARVQIVPLFETIEDLENSNEIMKQYLGYDIVKRWIKNSNNYQEIMLGYSD
SNKDGGYLSSGWTLYKAQNELTNIGEERGIKITFFHGRGGTVGRGGGPSYDAITSQPFGT
IKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTRQITDPDELVDFREIMDSI
VQDSNRIYRDLVFGNEHFYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFS
WSQNRIMLPGWYGVGSAFNHYIEAEEGNLEKLQHMFETWPFFRSLLSNVDMVLSKSDMNI
AFHYAQLAESEEVRSVFNIILDEWQLTKNVILAIEKHDDFLEESPSLKASLGFRLPYFNV
LNYIQIELIKRLRNNNLTDDEISLIHITINGIATGLRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttaacaaattggaaagcagtaacaaccaggaaatcatctctgaagaagttggt
atcttgaaagaattgttggatgatgcaacacgaggcatggctggtgagcaaggcctcacg
actatccaacatttggttgaactttatgatgaaggtgactatgaggcccttacacaagcc
atttcagaaatgacaaatgatgatatggtcgttgcatcacgttatttctctttgttacct
ctcttgattaatatctctgaggacgtggatttggcttatgaagtcaaccgcaaaaataat
attgatgaatcttatttaggtaagttgtctgaaacctttgatgttgtcgctgaaagcgac
aatgcgcgtgacattcttgaaaatgttaatgtcgtgccggtattgacagctcacccaact
caggttcaacgtaaaaccatgcttgaattgactaaccacattcacgaacttctccgtaag
catcgtgacgttaaggatggtcttattaataaggataaatggtatgcggatttgcgtcgt
tatgtagagattatgatgaaaacggatatcattcgtgagaagaaacttaaagttaaaaac
gaaatcactaacgttatggagtattacaactcctcattgattaaggcgattaccaagcta
tcgcatgaattcaaacgtttagcggttgaaaaaggtatcgaacttgataatccaacacct
attacaatgggaatgtggattggtggtgaccgtgacgggaacccatttgtaacggcagaa
actcttaaactttctgcgacattacaaagtgaagttatcctcaattactatattgaaaaa
gttgataatctttaccgctcattctcactctcatcacgtttgactgaagtttcagaaaca
gtagcagaaatggcgaaactttctccagatacatctgtctaccgtgaaaacgaaccatac
cgtcgtgctttcagttacattcaatctaaattgattcagacgcttcttttcttcaaagca
ggtaactttagcaaggaaagagctgctaagcgtctttctgaaaatgttcgtcttggctca
gtctcaacaggtgaagtagtagctgattttgtgcatgaccgtctcagccaaagtcttcaa
gctgtctcacaacaaactaccgaattttatgaaacagctgaagcattccatgatgatctt
ttggcaattaaaaattcacttctcgaaaatgatgattctgtcttgatttccggtgatttc
gaagagcttcttcaagctgttgaggtctttggattctaccttgcaacaattgatatgcgt
caggattcaagcgttcatgaagcttgtgtggcagagttgcttaaatctgcaaacattgtt
gacaactacagtgaattgacagaggttgaaaaggttgctgttcttcttaaagaattgcaa
gaagatccacgtaccttatcatcaacaaatgtatctaagtctgaaacgcttgaaaaagaa
ttagctatcttccgtactgctcgtcttttgaaggactatcttggtgaagaagtcatcaaa
caacatatcatctctcacactgagagcgtctcagatatgtttgagttagccatccttctt
aaagaagttggtttagttgatactgagcgtgcgcgtgtccaaatcgttccactgtttgaa
accatcgaagacttggaaaactctaatgaaatcatgaaacaataccttggttatgatatt
gttaaacgatggattaagaatagcaataactaccaagaaatcatgttgggttactcagat
tcaaacaaagatggtggttacttgtcttcaggttggacgctttacaaggctcagaacgaa
ttgaccaatattggtgaagagcgtggcattaaaattaccttcttccatggccgtggtggt
acagttggtcgtggtggtggcccatcttacgatgctattacttctcaaccatttggtact
attaaagaccgtatccgtttgacggagcaaggtgaggttatcggtaataaatatggcaat
aaggatgcagcttactacaatcttgaaatgctagtttcagctacgcttgatcgcatggta
acacgccaaattactgatcctgatgaattggttgatttccgtgaaattatggatagtatt
gttcaagattctaatcgtatttatcgagatcttgtcttcggaaatgaacatttctatgat
tacttctttgaagcaagtccaatcaaggaagtatcaagtttaaatattggttctcgtcca
gctgctcgtaagactattactgatatttcaggacttcgtgctattccttgggtattctca
tggtcacaaaaccgtatcatgttaccaggttggtatggtgtgggttctgcctttaatcac
tatattgaagctgaagaaggaaaccttgaaaaacttcaacacatgtttgaaacatggcca
ttcttccgttcacttttgtctaacgtggatatggtgctttcaaaatcagatatgaatatt
gccttccactatgcacagttggcagagagtgaagaagttcgtagcgtctttaacatcatt
ttggatgagtggcagctgactaagaatgtcattcttgcgattgaaaaacatgatgacttc
cttgaagaaagcccatctcttaaagcgagtttgggtttccgattgccatacttcaacgtc
ttgaactacatccaaattgaattgattaaacggcttcgtaataataatctgactgatgac
gaaattagtcttattcatattactatcaatggtattgcaacaggacttcgaaactctggt
taa

DBGET integrated database retrieval system