KEGG   Streptococcus thermophilus LMG18311: stu1542Help
Entry
stu1542           CDS       T00213                                 

Gene name
amyL
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    stu1542 (amyL)
Enzymes [BR:stl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     stu1542 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1358070..1359545
Genome map
AA seq 491 aa AA seqDB search
MSTNKEKTMTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDD
VGYGVYDLFDLGEFDQKGTIRTKYGLKEEYLNAINQLKNVGIIPMADVVLNHKAAADKLE
TFYVVEVDPEDRTKVISEPFEIEGWTHFTFDGRQKAYNDFEWHWYHFNGTDFDAKRNKKG
IYLIQGDNKGWAHNDLVDNENGNFDYLMFANLDYRHPEVIENIYEWADWFVETTGVQGFR
MDAIKHIDYFFMRNFIRDVKEKQGQDFYVFGEFWNAKEEDNNTYLEKTENRFDLVDVRLH
YNLYDASLKGADYDLTTIFEQTLVKNHPEHAVTFVENHDTQRGQALESTVEEWFKPSAYA
LILLRKDGLPCLFYGDYYGIDGEFAQESFKEVLDTLLYARKDLAYGEQTDYFDDPNCIGW
TRSGNEDCTPLAVTISNDAANNKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVS
EKSVSVWTIQD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactaataaggaaaaaactatgacaaatcaaactgcaatgcaatactttgaatgg
tatctcccaagtgacggccaacattggaacaacttagctgaagatgcccaacatctagca
gaccttggcatcagccatgtttggatgccacctgctttcaaagctactaacaaagatgat
gttggttacggagtctatgacctctttgaccttggggaattcgaccaaaaaggaaccata
cgcaccaaatatggtctcaaggaagaataccttaatgccatcaaccaactcaaaaatgtt
ggtatcatccctatggccgatgttgtgctaaaccacaaggcagccgcggataaacttgaa
accttttatgtggtagaagttgaccctgaggaccgtaccaaagtaatcagcgaaccgttt
gaaatcgagggttggactcatttcacttttgacggacgtcagaaagcttacaacgacttt
gaatggcactggtaccactttaatgggactgacttcgatgccaaaagaaataaaaaaggt
atctatcttatccaaggtgacaacaaaggctgggcacataatgacttggttgacaatgaa
aatggtaactttgactaccttatgtttgccaacctagattataggcatcctgaagttata
gaaaatatttacgaatgggctgactggttcgtcgaaacaactggtgtccaaggtttccga
atggatgccatcaagcacattgattatttctttatgcgtaattttattcgcgatgtcaaa
gaaaaacaaggtcaagatttctatgtttttggtgaattttggaatgccaaggaagaggat
aataatacttatctcgaaaaaactgaaaaccgctttgatcttgtggatgttcgccttcat
tacaatttatatgatgccagcctcaaaggagcagattacgatttgacgactattttcgaa
caaacattggtcaaaaatcaccctgagcatgcggtaaccttcgtagagaaccatgacacc
caacgtggacaagcattggaatctactgttgaagaatggtttaaaccatctgcctatgcc
ctcatccttcttcgtaaagacggccttccttgcctattttatggtgactactatggcatt
gatggtgagtttgctcaagaaagtttcaaagaggtcctagacaccttactctacgctcgt
aaagatttggcttatggagagcaaacagactactttgacgaccctaactgtattggatgg
acacgctctggtaatgaagactgtactccattagctgtaaccatttctaatgatgctgcc
aacaacaaatctatggaaattggaagtgattgggctggacaaactttctatgatattctt
ggaaactgctctgatactgtaacaattgacgaagacgggtggggagacttcccagtctct
gaaaaatctgtcagcgtttggacaattcaagactaa

DBGET integrated database retrieval system