KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4247Help
Entry
STM4247           CDS       T00065                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00473  D-Alanine metabolism
stm01100  Metabolic pathways
stm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STM4247 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STM4247 (alr)
Enzymes [BR:stm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     STM4247 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:stm01011]
 Precursor biosynthesis
  Racemase
   STM4247 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1255773
NCBI-ProteinID: NP_463112
UniProt: P0A1A3
LinkDB All DBs
Position
4468054..4469133
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFNA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagccaatcctgctgctggagggt
tttttcgacgccgccgatttgccgaccatttccgcgcaatgtctgcataccgccgtacat
aatcaagagcagcttgccgccctggaggcggtggagctggcggagccggtaacggtctgg
atgaagctggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaggcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttaatgcc
ttctgtcagggtaaacccggtcagcgctctattgccgcgtctggcggtatcctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcatcattttgtatggcgtatcgccgctg
gagcacaaaccctgggggccggattttggttttcagccggtgatgtccttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggctacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggcgatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtactggtcaatggtcgtgaagttccgattgtcgggcgg
gtggcgatggatatgatttgcgtagatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggtgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system