KEGG   Salinispora tropica: Strop_3967Help
Entry
Strop_3967        CDS       T00504                                 

Definition
(GenBank) DNA primase, small subunit
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
stp  Salinispora tropica
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:stp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Strop_3967
Enzymes [BR:stp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Strop_3967
DNA repair and recombination proteins [BR:stp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Strop_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4518881..4519789)
Genome map
AA seq 302 aa AA seqDB search
MSDRLRVDVAGRTLELSNLDKVLYPATGFTKGEVIDYYTRVAPVLLPHLSDRALTRIRFP
NGVDGSSFFEKNAPAATPSWVRTETLPVPGSAKGRETIDYVVADELPTLVWLANLAALEL
HTPQWQIGAHPDLMVVDLDPGEPAGLRQGCQVALLLRERLADDGIEAYPKTSGKKGMQLC
CPIAGTQPADVVSGYARRIAQELERAHPSLVVSKMARKLRAGKIFIDWSQNNAAKTTVAP
YSLRAQSVPAVSTPLTWAEVEAGGAGKRPSVRPYAAAEVLTRVAEQGDLLAPLLAGGPEL
PG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccggctccgggtcgacgtggctggccgcaccctggagttgtcgaatctggac
aaggtgctgtaccccgcgaccgggttcaccaagggtgaggtgatcgactactacacccgg
gtcgctccggtgctcctgccgcacctgtccgaccgggcgctgacccgaatccggttcccg
aacggcgtcgacggcagctccttcttcgagaagaacgcacccgcggcgacaccgagctgg
gtacgcaccgagacgttgcccgtccccggctcggcgaagggccgggagacgatcgactat
gtggtcgccgacgagctaccgaccctggtctggttggcaaacctcgccgccctcgaactc
cacacgccacagtggcagatcggggcacatccggacctgatggtggttgacctcgatccc
ggtgagccggccgggctacgccagggttgtcaggtagccctgttgctgcgggagcggctc
gccgacgacgggatcgaggcgtatccgaaaacctcggggaagaaggggatgcagctctgc
tgcccgatcgccggtacccaaccggccgacgtcgtctccggctacgcgcgacggatcgcc
caggagttggagcgggcccatccgagtctggtcgtgtccaagatggcgcgaaagctacgg
gcgggaaagatcttcattgactggagtcagaacaacgcggcgaagacgacggtggcgccg
tactcgctgcgtgcgcagtcggtgccggcggtgtccaccccgctgacctgggccgaggtg
gaggccggtggggccggcaaacggccgtcggtcaggccgtacgcggcggccgaggtgctc
acccgggttgcggagcagggcgacctgctcgccccgctccttgccggcggccccgagctg
ccgggatag

DBGET integrated database retrieval system