KEGG   Salinispora tropica: Strop_3968Help
Entry
Strop_3968        CDS       T00504                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
stp  Salinispora tropica
Pathway
stp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:stp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Strop_3968
Enzymes [BR:stp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Strop_3968
DNA repair and recombination proteins [BR:stp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Strop_3968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABP56398
JGI: Stro3968
UniProt: A4XBU1
LinkDB All DBs
Position
complement(4519782..4520720)
Genome map
AA seq 312 aa AA seqDB search
MPGVPPKPMLATTGELPAGAGWAYEFKWDGIRALVNIGDGQHRVYARSGVQVTVAYPELA
GLPAQVDDVLLDGEVVLFGETGQPSFTALAERMHVRDRGRAARLAASLPITYLVFDLLRL
DGIDLTGYSWQRRRAVLDELGLAGPRWAVPPAFTDGPATLQAAGEHGLEGVMAKRVGSVY
RPGTRSPDWVKVKLEVTGDFVVGGWRPGARRLGGLLVGVPRSDGRLAYRGRVGGGIGAAL
ERELLRELEPLRTGASPFVGDLPREDTRAVVWVAPRVVVEVKYGQLTPDGRLRFPRVLRL
RPDKLAEEVDDV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcgtgccgcccaagccgatgctcgcgacgaccggggagctgccggcgggcgcg
ggctgggcctatgagttcaaatgggacggaatccgagcgctggtcaacattggcgacggt
caacaccgggtgtacgcccgctctggcgttcaggtcaccgtcgcctacccggaactggcc
ggcctgcccgcgcaggtggatgacgtcctcctcgatggcgaggtggtgctcttcggcgag
accgggcagccttcgttcacggcgctcgccgagcgaatgcacgtccgggaccggggccgg
gctgcgcggctcgcggcgtccctgcccatcacgtacctggtcttcgacctgttgcggctc
gacggcatcgacctgaccggctactcgtggcagcggcggcgagccgttctcgacgagttg
gggttggccgggcctcgttgggcggtcccgccggctttcacggacggcccggcgaccctc
caggcggcgggggagcacggcctggagggggtgatggccaaacgggtcggttccgtctac
cggccgggtacgcgttcgccggactgggtcaaggtcaagttggaggtgaccggcgacttc
gtcgtgggtggctggcggccgggagcccgccggctcggcgggctgctggtcggggtgcca
cggtcggacggccgcctcgcctaccgggggcgggtcggcggtggcatcggtgcggcgctg
gagcgggaactgctgcgcgagctggaacccctgcgcaccggtgcttcccccttcgtcggg
gaccttccccgcgaggacacccgggcggtggtctgggtcgccccccgggtcgtggtggag
gtgaagtacggccagctcaccccggatgggcgactgcgctttccccgggtgctgcggttg
cgcccggacaaactcgccgaggaggttgacgatgtctga

DBGET integrated database retrieval system