KEGG   Streptomyces sp. CNQ-509: AA958_07440Help
Entry
AA958_07440       CDS       T03968                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:strc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AA958_07440
Enzymes [BR:strc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AA958_07440
DNA repair and recombination proteins [BR:strc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AA958_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKH82090
UniProt: A0A0F7N0D5
LinkDB All DBs
Position
complement(1791092..1792015)
Genome map
AA seq 307 aa AA seqDB search
MPVTEVEGRRLKLSNLDKVLWPEYGFTKGEALHYYAQVADVLLPHVRDRAASFLRFPDGV
DGERFFAKNAPAGTPEWVSVADVELTRSTVHHVLVQDLPTLLWAANLAALELHVPQWKAV
DPGAAPAAPVRADERLADRIVFDLDPGAPATVVECCRAALLVREALRADGLDAWPKTSGS
KGLHLYVPLAPASAEATSAYAKSLARRLEKEHPELILHRMARKLRPRKVFVDWSQNSRAK
TTVAPYVLRAQARPTVSTPLTWDEVEACADPDELVFLPGDVTERIATHGDLLAPLLDDHF
DLPDMTD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaccgaggtcgaaggacgccgcctgaagctcagcaacctcgacaaggtgctg
tggcccgagtacggcttcaccaagggcgaggcgctgcactactacgcccaagtcgccgac
gtcctcctgccgcacgtgcgcgaccgggccgcctccttcctgcgcttcccggacggcgtg
gacggggagcggttcttcgccaagaacgcccccgcgggcacgcctgaatgggtgagcgtc
gcggatgtcgagctgacccggagcaccgtgcaccacgtgctggtccaggacctgccgacg
ctgctctgggcggcgaacctcgccgcgctggagctgcacgtgccgcagtggaaggcggtg
gatcccggcgcggcgccggcggccccggtgagggcggacgaacggctcgccgaccggatc
gtcttcgacctcgaccccggcgcccccgccaccgtcgtcgagtgctgccgggccgcgctt
ctggtgcgcgaggcactgcgcgccgacgggctcgacgcctggccgaagacctccggctcc
aagggcctgcacctgtacgtgcccctcgcccccgcctccgccgaggccaccagcgcgtac
gcgaaatccctggcccggcgtctcgagaaggaacatccggagctgatcctgcaccggatg
gcgcggaaactgcgcccgcggaaggtcttcgtcgactggagccagaactcgcgggcgaag
accaccgtcgccccgtacgtgctgcgcgcccaggcccggccgaccgtctccaccccgctg
acctgggacgaagtggaggcatgtgcggatccggacgagctggtcttccttcccggtgac
gtgacggagcgcatcgccacgcacggtgacctgctggcgccgctgctcgacgaccacttc
gacctgccggatatgactgattag

DBGET integrated database retrieval system