KEGG   Streptomyces sp. CNQ-509: AA958_15575Help
Entry
AA958_15575       CDS       T03968                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AA958_15575
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA958_15575
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA958_15575
   00430 Taurine and hypotaurine metabolism
    AA958_15575
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AA958_15575
Enzymes [BR:strc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AA958_15575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3679151..3680533)
Genome map
AA seq 460 aa AA seqDB search
MALHQTERGVAGPYDDVYAMPISEHALPKYFMPEEVSDPRAVNALIRDELALDGNAAQNL
ATFCTTWAEDEVHSLMDECIGKNMVDKDEYPQTADIENRCVHILADLWHSPHGETTMGCS
TTGSSEAAMLGGLALKWRWRTRRKAEGKPADRPNLVCGPVQVCWEKFARYFDVELRQVPL
EPDATGLRPHQLREYVDENTIGVVAILGVTYTCDYEPVKEIAAELDAIQADTGLDVPVHV
DAASGGFVAPFLRPELEWDFRVERVASINSSGHKYGMAPLGVGWAIWRSADLLPEDLIFR
VSYLGGDMPTFALNFSRPGGEVVAQYYNLLRLGRAGYRRIYRAAAGSAEWLGEQIAGMGP
FTLLYDGRGALPAVSWTLTDPAGAGFTLYDVTEQLRLRGWQVPAYPLPPRRQETVIQRVL
IRHGISHDKIELLAADVREALDRLKDGAGTPAPQQPAFHH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgcaccagaccgagcgcggcgtcgccggaccgtacgacgacgtctacgcgatg
cccatcagcgagcacgcgctgcccaaatacttcatgcccgaggaggtctccgacccgcgc
gccgtcaacgcgctcatccgcgacgagctggccctcgacggcaacgccgcgcagaacctg
gcgacgttctgcaccacctgggccgaggacgaggtgcacagcctcatggacgagtgcatc
ggcaagaacatggtcgacaaggacgagtacccgcagaccgcggacatcgagaaccgctgc
gtgcacatcctcgccgacctgtggcactccccgcacggcgagacgaccatgggctgctcg
accaccggctccagcgaggccgcgatgctcggcggcctggcgctcaaatggcgctggcgc
acgcgccggaaggccgagggcaagcccgccgaccggccgaacctggtgtgcggtcccgtg
caggtgtgctgggagaagttcgcccgttacttcgacgtcgagctgcgccaggtgccgctg
gagccggacgccaccgggctgcgcccgcaccaactccgcgagtacgtcgacgagaacacc
atcggcgtcgtcgccatcctcggcgtcacatacacctgcgactacgagccggtcaaggag
atcgccgcggaactcgacgcgatccaggccgacacgggcctggacgtgcccgtgcacgtg
gacgccgccagcggcggcttcgtcgccccgttcctccgccccgagctggagtgggacttc
cgggtggagcgggtggcgtccatcaactcctccggccacaagtacggcatggcgcccctc
ggcgtcggctgggcgatctggcgctccgccgacctgctgcccgaggacctgatcttccgc
gtcagctacctcggcggcgacatgccgacgttcgcgctgaacttctcccggcccggcggc
gaggtcgtcgcgcagtactacaacctgctgcggctgggccgcgcgggctaccgccgcatc
taccgcgcggcggccggcagcgccgagtggctgggcgagcagatcgccggcatgggcccg
ttcacgctgctgtacgacgggcgcggcgcgctgccggcggtgtcgtggacgctgacggac
ccggcgggcgcgggcttcacgctgtacgacgtgacggagcaactgcggctgcgcggctgg
caggtcccggcgtacccgctgccgccgcggcggcaggagacggtcatccagcgggtgctg
atcaggcacgggatcagccacgacaagatcgagctgctggcggcggacgtacgggaggcg
ctcgaccggctgaaggacggggccggaacaccggcgccgcagcagccggccttccaccac
tga

DBGET integrated database retrieval system