KEGG   Streptomyces sp. CNQ-509: AA958_21540Help
Entry
AA958_21540       CDS       T03968                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00564  Glycerophospholipid metabolism
strc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AA958_21540
Enzymes [BR:strc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AA958_21540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKH84353
UniProt: A0A0F7NA33
LinkDB All DBs
Position
4974815..4976521
Genome map
AA seq 568 aa AA seqDB search
MKTAVLGPAERGAALAQMAERELDLLVVGAGVVGAGTALDAATRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLTERLAPHLVKPVPFLYPLKHRAWERAY
AGSGVLLYDAMSVARAHGRGMPAHRHLSRSHALRVAPCLRKDALVGALQYYDAQVDDARY
VATLVRTAAQYGAQVANRARVVGFLREGERVVGARVHDLEQGGEFEVRARQVVNATGVWT
DETQAMVGERGQFHVRASKGIHLVVPKDRIHSTSGLLLRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNAVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVGPCVTEDVRLLGAEGYQAL
WNARARTAARTGVHVARVEHLLNRYGSLSEEVLELIERDPSLGLPLTGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTQCAAEVAALMAPVLGWDGDQVEREVAHYDKRV
EAERESQRQPDDQTADAARLGAPEIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcggtactggggccggccgagcgcggcgcggccctcgcacagatggccgag
cgcgagctggacctgctggtcgtcggcgccggcgtggtcggcgcgggcaccgcgctggac
gcggcgacccgcggcctggccaccgggctggtcgaggcgcgggactgggcgtcgggcacg
tcgagccggtcgagcaagctcatccacggcgggctgcgctatctggagatgctggacttc
gcgctcgtccgcgaggcgctgaaggagcgcgggctgctcaccgagcgcctggcgccgcac
ctcgtcaagccggtgccgttcctctatcccctcaagcaccgcgcctgggagcgggcgtat
gccggctccggcgtgctgctctacgacgccatgtccgtcgcccgcgcacacggccgcggc
atgcccgcgcaccgtcacctctcccgctcgcacgccctgcgtgtcgcgccgtgtctgcgg
aaggacgcgctcgtcggcgcactgcagtactacgacgcgcaggtcgacgacgcccgttac
gtcgccacgctcgtgcgcaccgccgcgcagtacggggcgcaggtcgccaaccgcgcgcgg
gtcgtgggcttcctgcgggagggcgagcgcgtcgtgggcgcgcgggtgcacgacctggag
cagggcggggagttcgaggtacgggcgcggcaggtcgtcaacgccaccggggtgtggacg
gacgagacgcaggcgatggtcggcgagcgcgggcagttccacgtgagggcgtcgaagggc
atccacctcgtcgtaccgaaggaccgcatccactccacctccggcctcctcctgcgcacc
gagaagagcgtgctcttcgtcatcccctgggggcggcactggatcatcggcaccacggac
accgactgggacctcgacaaggcccatcccgcggcctcctccgccgacatcgactacctg
ctggagcacgtcaacgccgtgctcgcggtgccgctgacgcgagacgacgtcgagggcgtg
tacgcgggcctgcggccgctgctcgccggcgagtccgacgcgaccagcaagctgtcgcgc
gagcacaccgtggcgcacccggtgcccgggctcgtcgtcgtcgcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgaggccgtgcacgggctcgaccagcgc
gtcgggccgtgcgtcacggaggacgtgcggctgctgggcgcggaggggtaccaggcgctg
tggaacgcgcgggcgcggaccgcggcgcggacgggggtgcacgtcgcgcgggtggagcac
ctgctgaaccggtacgggtcgctgtcggaggaggtgctggagctgatcgagcgggacccg
tcgctcggcctgccgctcacgggcgcggacgactatctgcgcgcggaggtcgtctacgcg
gcctcgcacgagggcgcgcgccacctcgacgacgtgctgacgcggcgtacccggatctcc
atagagaccttcgaccgcggtacgcagtgcgccgccgaggtcgccgcgctgatggcgccg
gtgctcggctgggacggcgaccaggtcgagcgtgaggtggcgcactacgacaagcgggtc
gaggccgagcgcgagtcgcagcggcagccggacgaccagacggcggacgcggcgcggctg
ggcgcaccggagatcgtgccgttgtga

DBGET integrated database retrieval system