KEGG   Streptomyces sp. CCM_MD2014: NI25_17895Help
Entry
NI25_17895        CDS       T04862                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strd00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    NI25_17895
Enzymes [BR:strd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     NI25_17895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4099943..4101154)
Genome map
AA seq 403 aa AA seqDB search
MSEPKSLAGEAEQLDAADGLAAVRERFVLDDVTYLDGNSLGALPVHVPARVEDVVRRQWG
ELRIRSWEESGWWTAPERIGDRIAPLVGAAAGQVVVGDSTSVNVFKALVAAVRMAQEDRP
GRDEILVDATTFPTDGYIAESAARMTGCALRPVAPAEVPSALGDRTAAVLLNHVDYRTGR
LHDLPALTAAVHAAGAYAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAYLY
VRRDLQPRFDSPLPGWNSHAEPFGMRSGYAPASGAVRGRVGTPDILSLLALEAALDVWDE
DGVSVAAVRAKSLALTDFFLRCVGAYVPDGRVESVTPAAHAERGSQVALRCDDAGEVMKR
LIERGVVGDYRAPDVLRFGFTPLYVGFADVERAARVLARTLAG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccgaagagcctcgcgggcgaggcggagcaactggacgccgccgacgggctg
gcggcggtgcgcgagcgtttcgtcctcgacgacgtgacctacctcgacggcaactcgctg
ggcgccctccccgtgcacgtccccgcgcgcgtggaggacgtcgtacggcgtcagtggggc
gagttgcgcatccggtcctgggaggagagcggctggtggaccgcgcccgagcggatcggc
gaccggatcgccccgctggtcggcgcggccgccgggcaggtcgtcgtcggggactcgacc
agcgtcaacgtcttcaaggcgctcgtcgccgcggtgcgcatggcgcaggaggaccggccc
gggcgggacgagatcctcgtggacgccaccacgttccccacggacgggtacatcgccgag
tcggcggcccggatgacggggtgcgccctgcgtccggtcgccccggccgaggtgccgtcg
gcgctgggggaccgtacggcggccgtgctcctcaaccacgtcgactaccgcacgggccgg
ctgcacgacctgcccgcgctcacggcagcggtgcacgcggcgggggcgtacgcggtgtgg
gacctgtgccacagcgccggcgcgctgccggtcgggctggacgagcacggcgtcgacctg
gcggtcggctgtacgtacaagtacctcaacggcggccccggctcgcccgcctacctgtac
gtgcgccgcgacctccagccccgtttcgactccccgctgccgggctggaactcgcacgcc
gagccgttcggcatgcggtccggctacgccccggcctccggcgcggtgcgcgggcgggtc
gggacgccggacatcctctccctgctcgccctggaggcggcgctggacgtgtgggacgag
gacggtgtctccgtggcggcggtgcgggccaagtcgctggcgctgacggacttcttcctg
cgctgcgtcggggcgtacgtccctgacggccgcgtggagtccgtgaccccggcggcacac
gccgagcgcggcagccaggtcgcgctgcgctgtgacgacgcgggcgaggtgatgaagcgg
ctgatcgagcgcggggtggtcggcgactaccgcgcccccgacgtgctgcgcttcggcttc
accccgctgtacgtcggcttcgcggacgtggagcgggcggcgcgggtgctggcgcggacg
ctggcgggctga

DBGET integrated database retrieval system