KEGG   Streptomyces sp. 769: GZL_05327Help
Entry
GZL_05327         CDS       T03587                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (GTP)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stre  Streptomyces sp. 769
Pathway
stre00620  Pyruvate metabolism
stre00680  Methane metabolism
stre01100  Metabolic pathways
stre01120  Microbial metabolism in diverse environments
stre01200  Carbon metabolism
Module
stre_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:stre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GZL_05327
  Energy metabolism
   00680 Methane metabolism
    GZL_05327
Enzymes [BR:stre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GZL_05327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase FtsQ
Motif
Other DBs
NCBI-ProteinID: AJC57903
UniProt: A0A0A8EQ04
LinkDB All DBs
Position
5729947..5732745
Genome map
AA seq 932 aa AA seqDB search
MTAPSLQGAAPVSSADNTPAELATPGTPQGTKGDNGALRADIRRLGDLLGETLVRQEGQD
LLDLVEQVRALTRTDGEAAARLLGETDLATAAKLVRAFSTYFHLANVTEQVHRGRELRAR
RAAEGSILARTADMLKDADPEHLRETARNLGVRPVFTAHPTEAARRSVLTKLRKIAELLD
RIDAADRRRVDLRLAENIDLIWQTDELRVARPEPTDEARNAIYYLDELGRGAVGDVLEDL
AAELARAGTELPAGTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGITDALEHVDE
LRGALSNSIRNCGATDELLTSLQRDLDLLPEISPRYKRLNSEEPYRLKATCIRQKLLNTR
ERLASDTPHVPGRDYLGTSELLDDLTLIQTSLRAHRGGLIADGRLERTLRTIGAFGLQLA
TMDVREHADAHHHALGQLFDRLGEESWRYVDMPRDYRRKLLAKELRSRRPLAPTPAPLDE
AGAKTLGVFRTVRQAKKTFGPEVIESYIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKI
GIVPLLETTDELKIADQLLDDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWE
IHRAQRLLRDVAHRHGVRLRLFHGRGGTVGRGGGPSHDAILAQPYGTLEGEIKVTEQGEV
ISDKYLVPSLARENLELTVAATLQASALHTAPRQSDEALARWDAAMETVSEAAHGAYRRL
VEDPDLPAYFFASTPVDQLAELHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGW
FGVGTGLKAAREAGLDTVLDEMHEHWHFFRNFLSNVEMTLAKTDLRIAQHYVDTLVPDEL
RHVFDVIKAEHELTVAEVLRITGEAELLDSNPVLKQTFHVRDAYLDPISYLQVTLLKRQR
DAAAAEEQPDPLLSRALLLTVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaccatccctgcaaggagccgcacctgtgagcagtgccgacaacacccccgcc
gagctcgccacccccggaactccccagggcaccaagggtgacaacggtgccctgcgcgcc
gacatccgccgcctcggcgacctcctcggcgagaccctcgtccggcaggaaggtcaggac
ctcctcgacctcgtcgaacaggtccgcgccctgacccgcaccgacggcgaggccgctgcc
cggctcctcggcgagaccgacctggccaccgccgccaagctggtccgcgccttctccacc
tacttccacctggccaacgtcaccgagcaggtccaccgcggtcgcgagctccgcgcccgg
cgcgccgccgagggcagcatcctcgcccgcaccgccgacatgctcaaggacgccgacccc
gagcacctgcgggagacagcccgcaacctcggcgtccgcccggtcttcaccgcccacccc
accgaggccgcccgccgctccgtcctcaccaagctccgcaagatcgccgagctgctggac
cgcatcgacgccgccgaccgccgccgggtggatctccgcctcgccgagaacatcgacctc
atctggcagaccgacgagctgcgggtggcccgccccgagcccaccgacgaggcccggaac
gccatctactacctcgacgagctcggccgcggcgcggtcggcgacgtcctggaggacctc
gccgccgaactcgcccgcgccggcaccgagctgcccgccggcacccgcccgctgaccttc
ggcacctggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgg
gacgtgctgatcctccagcacgagcacggcatcaccgacgccctggagcacgtcgacgaa
ctccgcggcgccctctccaactccatccgcaactgcggcgccaccgacgaactcctgacc
tccctccagcgggacctcgacctcctccccgagatcagcccccgctacaagcgtctcaac
agcgaagagccctaccgcctcaaggccacctgcatccgccagaagctcctcaacacccgc
gagcggctggccagcgacaccccccacgtgcccggccgcgactacctcggcaccagcgaa
ctcctcgacgacctcaccctgatccagacctcgctgcgcgcccaccgcggcggcctgatc
gccgacggccgcctggagcgcaccctgcgcaccatcggcgcgttcggcctccagctcgcc
accatggacgtccgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgac
cgcctcggcgaggagtcctggcgctacgtggacatgccgcgcgactaccgccgcaagctc
ctcgccaaggagctccgctcccgccggccgctcgcccccaccccggcgcccctcgacgag
gccggcgccaagaccctcggcgtcttccgcaccgtccgccaggccaagaagaccttcggc
cccgaggtcatcgagtcctacatcatctcgatgtgccagggctccgacgacgtcttcgcc
gccgccgtcctcgcccgcgaggccggcctgatcgacctgcacgccggctgggccaagatc
ggcatcgtcccgctgctggagaccaccgacgagctgaagatcgccgaccagctcctcgac
gacatgctctccgacccctcctaccgccgcctggtcgccctgcgcggcgacgtccaggag
gtcatgctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggag
atccaccgcgcccagcgcctgctccgcgacgtcgcccaccggcacggcgtccggctgcgg
ctcttccacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatc
ctcgcccagccctacggcaccctcgaaggcgagatcaaggtcaccgagcagggcgaggtc
atctccgacaagtacctcgtgccgtcgctcgcccgggagaacctggagctgacggtcgcc
gcgaccctccaggcgtccgcgctgcacaccgccccccgccagtccgacgaggccctggcc
cgctgggacgccgcgatggagaccgtctccgaagccgcccacggcgcctaccgccggctc
gtcgaagaccccgacctgcccgcctacttcttcgcctccacccccgtcgaccagctcgcc
gaactccacctcggctcccgcccgtcccgccgccccgactccggcgccggcctcgacggc
ctccgcgccatcccgtgggtcttcggctggacccagtcccggcagatcgtccccggctgg
ttcggcgtcggcaccggcctcaaggccgcccgcgaggccggcctggacaccgtcctcgac
gagatgcacgagcactggcacttcttccgcaacttcctgtccaacgtcgagatgacgctg
gccaagaccgacctgcggatcgcccagcactacgtcgacaccctcgtcccggacgagctc
cggcacgtcttcgacgtcatcaaggccgagcacgagctgaccgtcgccgaggtgctgcgc
atcaccggcgaggccgaactcctcgactccaacccggtgctcaagcagaccttccacgtc
cgcgacgcctacctggacccgatctcctacctccaggtcaccctcctcaagcgccagcgc
gacgccgccgcggccgaggagcagcccgacccgctgctctcccgcgccctcctcctcacc
gtcaacggcgtcgccgccggcctccgcaacaccggctga

DBGET integrated database retrieval system