KEGG   Streptomyces sp. 4F: ASR50_21825Help
Entry
ASR50_21825       CDS       T04265                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00564  Glycerophospholipid metabolism
strf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ASR50_21825
Enzymes [BR:strf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ASR50_21825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ALV51783
UniProt: A0A0U3GKJ3
LinkDB All DBs
Position
4841476..4843131
Genome map
AA seq 551 aa AA seqDB search
MAERELDVLVVGGGVVGAGTALDAVTRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLEKLAPHLVRPVPFLYPLQHKGWERLYAGAGVALYDTMAMTHGH
GRGLPVHRHLSRRHALRVAPCLKKDALVGALQYYDAQMDDARFVLNLVRTAAAYGARTAN
GARVTGFLREGERVVGARVQDVEGGGEYEIRAKQVVNATGVWTDDTQAMVGERGQFHVRA
SKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTDTGWDLDKAHPAASSADI
DYLLEHVNSVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDAAVHGLDLRVADCVTEETPLVGAEGYHALWNGRARTAARTGLHPVR
VEHLLQRYGSLAEEVLDLVASDPSLGEPLQAADDYLRAEVVYAASHEGARHLEDVLTRRT
RISIETFDRGTRSAREAAELMAPVLGWDSGQIDREVQHYEKRVEAERESQRQPDDLTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgcgagctggacgtactggtggtgggcggcggcgtggtcggcgcgggcacg
gcgctcgacgcggtgacgcgcggcctgtccaccggactggtcgaggcgcgtgactgggcg
tcgggcacctccagccgctccagcaagctgatccacggcggcctgcgctatctggagatg
ctggacttcgcgctcgtccgcgaggcgttgaaggagcgtggcctgctcctggagaagctc
gccccgcacctggtgcgcccggtgccgttcctgtacccgctgcagcacaagggctgggag
cggctctacgccggcgcgggcgtcgcgctctacgacaccatggcgatgacccacggccac
ggacggggcctccccgtgcaccgccacctgagccgccgtcacgccctgcgggtcgcgccc
tgcttgaagaaggacgcgctggtcggagccctgcagtactacgacgcccagatggacgac
gcccgcttcgtcctcaacctcgtgcgcacagcggcggcgtacggcgcccggacggcgaac
ggcgcccgcgtcaccgggttcctccgcgagggcgagcgggtcgtcggcgcccgcgtgcag
gacgtggagggcggcggcgagtacgagatccgcgccaagcaggtggtcaacgccaccggg
gtgtggaccgacgacacccaggcgatggtcggcgagcgcggccagttccacgtgcgcgcc
tccaagggcatccacctggtcgtgcccaaggaccgcatccactccaccaccgggctgatc
ctgcgcaccgagaagtccgtgctgttcgtcatcccctggggccggcactggatcgtcggc
accaccgacaccggctgggacctcgacaaggcgcacccggccgcgtccagcgccgacatc
gactacctgctggagcacgtcaactccgtcctcgcggtgccgctcacccgcgacgacgtc
gaaggggtgtacgcggggctgcgcccgctgctcgccggcgagtcggacgccacgagcaag
ctgtcccgcgagcacacggtcgcccacccggtccccggcctggtcgtggtcgcgggcggc
aagtacacgacgtaccgggtgatggccaaggacgccgtggacgccgcggtgcacgggctc
gacctgcgcgtggcggactgcgtcaccgaggagacgccgctggtgggcgcggagggctac
cacgccctgtggaacggccgggcccgcacggccgcccgcaccggcctccacccggtccgg
gtggagcacctgctccagcggtacgggtcgctcgccgaggaggtgctggacctcgtcgcc
tccgacccgtccctgggcgagccgcttcaggccgccgacgactacctgcgcgccgaggtc
gtctacgccgcctcgcacgagggcgcgcgccatctggaggacgtgctcacccggcgcacg
cggatatccatcgagacgttcgaccggggcacgcgcagcgcgcgggaggccgccgagctg
atggcgcccgtgctgggctgggacagcggccagatcgaccgcgaggtgcagcactacgag
aagcgggtggaggccgagcgggagtcgcagcgccagcccgacgacctgaccgcggacgcg
gcccgtctgggggcgccggacatcgtgcccctgtag

DBGET integrated database retrieval system