KEGG   Streptomyces sp. Mg1: M444_06935Help
Entry
M444_06935        CDS       T03958                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00020  Citrate cycle (TCA cycle)
strm00480  Glutathione metabolism
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
strm01120  Microbial metabolism in diverse environments
strm01130  Biosynthesis of antibiotics
strm01200  Carbon metabolism
strm01210  2-Oxocarboxylic acid metabolism
strm01230  Biosynthesis of amino acids
Module
strm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:strm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M444_06935
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M444_06935
Enzymes [BR:strm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M444_06935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AKL65164
UniProt: B4VD25
LinkDB All DBs
Position
1:complement(1707820..1710039)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIQAYASTAGVNVETRDISLAGRIIASFPEHLEEGQ
RIADALAELGELAKTPEANIIKLPNISASIPQLKAAIAELQGQGYALPNYPDDPKTDEER
ETRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTPESKTNVATMGEND
FRSTEKSAVISEAGTLRIEHVAADGATTVLRDSVPVLAGEVVDASVLHVDALRTFLNAQI
ERAKAEDVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFARYGETLAAAGLSPNDGLGTI
LNGLGALPDADAIKASFDAEIAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGNEADTLAVLPDSSYAGVYQAVIDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIAAAGTVRLVDAEGNTVLEQEVAAGDIFRACQTKDAPIQDWVKLAVTRARATGV
PAVFWLDEGRAHDAQLIAKVKTYLADHDTEGLTIEILSPVKATAYSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGTFLNEDKSPSRKLGGIDNRGSHFY
LALYWAQELARQTDAPKLAAAFDPLAKTLAESEDKIVAELIAVQGSPAEIGGYYQPDAAK
AAAIMRPSATFNQAIASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacgcacactgacgaggccccggccctcgcgacgtat
tcgttcctgcctgtgatccaggcgtacgcgtcgacggccggtgtgaatgtcgagacccgt
gacatctccctggccggtcggatcatcgccagcttcccggagcacctggaagagggccag
cgcatcgcggacgccctcgccgagctcggtgagctggcgaagacgccggaagccaacatc
atcaagcttccgaacatctcggcttcgatcccgcagctgaaggccgcgatcgccgagctc
cagggccagggctacgccctcccgaactacccggacgacccgaagaccgacgaggagcgc
gagacccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcctcggtgaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggacccccgagtcgaagacgaacgtcgccaccatgggcgagaacgac
ttccgctcgaccgagaagtccgccgtgatctccgaggccggcacgctccgcatcgagcac
gtcgccgccgacggcgccaccacggtgctgcgcgactccgtaccggtcctcgccggtgag
gtcgtggacgcgtccgtcctgcacgtcgacgcgctgcgcaccttcctgaacgcccagatc
gagcgcgccaaggccgaggacgtcctgttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtggtccgcgccttcttcccgaagaccttcgcc
cgctacggcgagaccctggccgccgccggcctgtccccgaacgacggcctcggcaccatc
ctgaacggcctgggcgcgctgcccgacgccgatgcgatcaaggcctccttcgacgccgag
atcgccgagggcccggccctcgcgatggtggactcggacaagggcatcaccaacctgcac
gtcccgtccgacgtcatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggcaacgaggccgacaccctcgcggtcctcccggacagcagctac
gcgggcgtctaccaggccgtcatcgacgactgccgcgcgcacggcgcgttcgacccggcc
accatgggctcggttccgaacgtcggcctgatggcccagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgccgccgcgggcaccgtccgcctcgtcgacgccgagggc
aacacggtcctggagcaggaggtcgccgccggcgacatcttccgcgcctgccagaccaag
gacgcgccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggcgtc
ccggccgtcttctggctcgacgagggccgcgcgcacgacgcgcagctgatcgccaaggtc
aagacgtacctcgccgaccacgacaccgagggtctgaccatcgagatcctctcgccggtc
aaggccaccgcctactcgctggagcggatccgccgcggcgaggacaccatctcggtgacc
ggcaacgtgctgcgcgactacctgaccgacctcttccccatccttgagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctcttcgagacgggcgcc
ggcggctccgccccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
tccctcggtgagttcctcgcgctggccgtctccttcgagcacctcgcgaccaccaccggc
aacgcccgcgcccaggtgctggccgacaccctggaccgcgcgaccggcaccttcctcaac
gaggacaagtcgccgagccgcaagctgggcggcatcgacaaccgcggcagccacttctac
ctcgccctgtactgggcgcaggagctggcccgccagaccgacgccccgaagctggcggcc
gccttcgacccgctcgccaagacgctggccgagtccgaggacaagatcgtcgccgagctg
atcgcggtccagggctccccggccgagatcggcggctactaccagcccgacgcggccaag
gccgcggcgatcatgcgcccgtccgccacgttcaaccaggcgatcgcgagcctggcctga

DBGET integrated database retrieval system