KEGG   Streptomyces sp. PAMC 26508: F750_3385Help
Entry
F750_3385         CDS       T02619                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    F750_3385
Enzymes [BR:strp01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     F750_3385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3564297..3565493)
Genome map
AA seq 398 aa AA seqDB search
MSDLEERAEALDSADGLAALRELFTLDDTVYLDGNSLGALPRHVPARMQDVITREWGSLR
IRSWDESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKAVVAASRLADEGRDEIL
VDATTFPTDGYIAGSAARMTGHRVVPVDPAEVRGALGPRTAVVLLNHVDFRTGRLHDLPG
LTAAVHEAGALAVWDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPGSPAYLYVAERHQ
TAFDSPLPGWTSHADPFAMSPGYAPAEGSVRGRVGTPDILSMLALEAALDVWDGVSVDAV
RAKSLALTDFFLECVAAYVPEGRVVPVTPAAHEERGSQVSLRCENADETEAVMRALTERG
VVGDLRRPDILRFGFTPLYVGFADAERAARILAEVLAV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctcgaggagcgcgccgaggcgctcgactccgccgacgggctcgccgcgctg
cgcgagctgttcacgctcgacgacaccgtctacctcgacggcaactcgctgggcgcgctg
ccccgtcacgttcccgcccgtatgcaggacgtcatcacccgtgagtggggctcgctgcgc
atccgctcctgggacgagagcggctggtggaccgcgcccgagcggatcggcgaccggatc
gccccgctggtcggcgcggccgccggacagatcgtggtgggcgactccaccagtgtgaac
gtcttcaaggccgtggtggccgcgagccgcctcgccgacgagggccgggacgagatcctg
gtcgacgccacgacgttccccacggacgggtacatcgccggttcggcggctcggatgacg
ggccaccgtgtcgtccccgtcgacccggccgaggtgcggggtgcgctcggcccccgtacg
gcggtcgtgctcctgaaccacgtcgacttccgtacgggccggctccacgacctgcccggt
ctcaccgccgccgtccacgaggcgggtgcgctcgccgtctgggacctgtgccacagcgcg
ggcgccctgccggtgggcctcgacgcgcacggtgtggacctcgccgtcggctgtacgtac
aagtacctcaacggcggccccggctcgcccgcctacctgtacgtcgccgagcgccatcag
acggcgttcgactcgcccctgcccgggtggacctcgcacgccgatccgttcgcgatgtcc
cccggatacgcccccgcggagggttccgtacggggacgcgtcggcaccccggacatcctg
tccatgctggccctggaggcggcgctggacgtctgggacggtgtgtcggtcgatgcggtg
cgggccaagtcgctggcgctcacggacttcttcctggagtgcgtcgccgcctacgtcccc
gagggccgggtcgtccccgtcaccccggccgcccacgaggagcgcggcagccaggtctcg
ctgcggtgcgagaacgcggacgagacggaagcggtgatgcgcgcgctcaccgagcggggt
gtggtcggcgacctgcgccgcccggacatcctgcgcttcggcttcaccccgctgtacgtc
ggtttcgccgacgcggaacgggcggcgcggatcctcgccgaggtactggcggtctga

DBGET integrated database retrieval system