KEGG   Streptomyces sp. PAMC 26508: F750_5888Help
Entry
F750_5888         CDS       T02619                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    F750_5888
   00650 Butanoate metabolism
    F750_5888
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F750_5888
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F750_5888
Enzymes [BR:strp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     F750_5888
Amino acid related enzymes [BR:strp01007]
 Aminotransferase (transaminase)
  Class III
   F750_5888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6268502..6269785
Genome map
AA seq 427 aa AA seqDB search
MTGLYERHLAVSPEWLALYYRNPLELTHGEGRHVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRLIHSSTLYLNRPMVELAERIAALSGIPDARVFFTTSGTEANDAALLLAT
AHRASNQILAMRNSYHGRSFSTVSVTGNGSWSTTSLSPLQTLYVHGGVRTRGPYAELSDE
RFIRACVADLEDLLGHTRGVAALIAEPVQGVGGFTAPPDGLYAAFREVLDRHGILWISDE
VQTGWGRTGDHFWGWQAHAASGPPDILTFAKGIGNGMSIGGVVARADVMNCLDANSISTF
GGSPVTMAAGLANLSYLLEHDLQGNARRVGGLLIERLRAVGAGSPAVREVRGRGLMIGIE
LVKPGSDEADPEAAAAVLEAARAGGLLIGKGGGHNTSVLRIAPPLSLTVAEAEEGAEILG
EALHAAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggactgtacgaacggcacctggccgtcagcccggagtggctggcgctctactac
cgcaaccccctcgaactcacccatggcgaggggcgccacgtctgggacgcggacggcaac
cgctacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgcccgag
gtgaccaaggccgtctcggagcaggcaggccgtctcatccactcctcgacgctctacctc
aaccgccccatggtcgagctcgccgagcggatcgccgccctctccggaatccccgacgcc
cgggtcttcttcaccacctcgggcaccgaggccaacgacgcggccctgctgctggccacc
gcccaccgcgcgtccaaccagatcctggcgatgcgcaacagctaccacggcaggtcgttc
tcgacggtctccgtcacgggcaacgggtcctggtcgaccaccagcctgtcgcccctgcag
acgctctacgtccacggcggggtccgcacccgaggaccgtacgccgagctgagcgacgaa
cggttcatcagggcctgtgtggccgatctggaggacctgctcggccacaccaggggcgtc
gcggcgctgatcgccgaacccgtgcagggggtcggcgggttcaccgcaccacccgacggg
ctgtacgcggcgttccgcgaggtcctcgaccggcacggcatcctgtggatctccgacgag
gtgcagacggggtggggacgcaccggcgaccacttctggggctggcaggcccacgcggcg
agcgggccgcccgacatactcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggagtcgtcgcccgggcggacgtcatgaactgcctcgacgccaactccatctcgacgttc
ggcggatccccggtcaccatggcggcgggcctcgccaacctctcgtacctgctggaacac
gacctccagggcaacgcccggcgggtcggcggcctgctcatcgagcgcctgcgggcggtc
ggcgcgggttcacccgccgtacgggaggtacgcggccggggtctcatgatcggcatcgag
ctcgtgaaacccggcagcgacgaggccgacccggaggccgccgccgcggtcctcgaggcg
gcccgcgccgggggtctgctcatcggcaagggcggcggccacaacaccagtgtgctgcgg
atcgcgccgccgctgtcgctgaccgtcgccgaggccgaggagggcgccgagatcctgggc
gaggcgctgcacgcggcagcctga

DBGET integrated database retrieval system