KEGG   Streptomyces sp. PAMC 26508: F750_6167Help
Entry
F750_6167         CDS       T02619                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
strp  Streptomyces sp. PAMC 26508
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6574672..6575733)
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVKPMLAKSVSAIPPGMQYEAKWDGFRAIVHRDGDEVVIGSRTGKPLTRYFPE
VVTALLENLPRRCVIDGEIVLPYDGRLDFDRLSERIHPADSRVRTLAERTPASFVAFDVL
ALDDTSLLAAPQTERRRILEEALAEASAPVHLAPSTTDPALAREWFERYEGAGLDGVVAK
PLDLPYRPDARVMYKIKHERTADCVVAGYRFHKSGPVVGSLLLGLYDSGGALQHVGVCAA
FSMKRRAELVEELDPLRIEPAEHPWAAWADAAAHEGSRLPGAPSRWSGKKDLSWVALAPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRTPSGCTYAQLEEVVRYDLAEVLSAR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgcctcccgtgaagccgatgctcgccaagtccgtgtccgcgatt
ccccccgggatgcagtacgaggcgaagtgggacgggttccgggcgatcgtgcaccgtgac
ggcgacgaggtggtgatcggcagccggacgggcaagcccctgacccgctacttccccgag
gtggtcacagccctgctggagaaccttccccggcgctgtgtgatcgacggtgagatcgtc
ctgccgtacgacgggcggctggacttcgaccggctgagcgagcgcatccatccggccgac
tcccgggtccggacgctcgccgaacggaccccggcgagcttcgtcgccttcgatgtcctc
gccctggacgacacgtccctgctggccgctccgcagaccgagcggcgcaggatcctggag
gaggcgctggcggaggcctcggcgcccgtccatctcgccccctccaccacggatccggcc
ctcgcgcgggagtggttcgagcggtacgagggggcggggctcgacggagtggtcgccaaa
ccgctcgatctgccgtaccggccggacgcccgcgtcatgtacaagatcaagcacgaacgg
acagcggactgcgtggtggcgggctaccgcttccacaagagcggccccgtggtgggctcg
ctgctgctcgggctgtacgactccgggggcgccctgcagcacgtgggggtgtgcgccgcc
ttctcgatgaagcggcgcgccgaactggtcgaggagctggatccgttgcgcatcgagccg
gcggaacatccgtgggccgcctgggcggacgcggcggcgcacgagggttcacggctgccg
ggcgctccgagccgctggtcgggcaagaaggacctgtcctgggtggcgctcgcgcccgag
cgggtctgcgaggtggcgtacgaccacatggagggtgaccgcttccgccacaccacccag
ttccgccggtggcggccggaccgcaccccctccggctgcacgtacgcgcagctggaggaa
gtggtgcgctacgacctggccgaggtgctgagcgcccgctga

DBGET integrated database retrieval system