KEGG   Streptococcus salivarius NCTC 8618: SSAL8618_04150Help
Entry
SSAL8618_04150    CDS       T03511                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strs  Streptococcus salivarius NCTC 8618
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:strs00001]
   00620 Pyruvate metabolism
    SSAL8618_04150
  Energy metabolism
   00680 Methane metabolism
    SSAL8618_04150
Enzymes [BR:strs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SSAL8618_04150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
821497..824319
Genome map
AA seq 940 aa AA seqDB search
MAFNKLESSNNQEIISEEVGILKELLDDATRGMAGEQGLTTIQHLVELYDEGDYVALTQA
ISEMTNDDMVVASRYFSLLPLLINISEDVDLAYEVNHKNNIDESYLGKLSETFDVVAESE
NARDILEHVNVVPVLTAHPTQVQRKTMLELTNHIHELLRKHRDVKAGLINKDKWYADLRR
YVEIMMQTDIIREKKLKVKNEITNVMEYYNSSLIKAITNLSHEFKRLAVEKGIELDNPTP
ITMGMWIGGDRDGNPFVTAETLKLSATVQSEVILNYYIEKVDNLYRSFSLSSRLTEVSDT
VAEMAKHSPDTSVYRENEPYRRAFSYIQSKLIQTLLFFKEGNFSKERVAKRLSENVRLGS
ASTGEVVADYVQQRLSQSLQAVSQQTTEFYETAEDFHDDLLAIKNSLLENDDAVLISGDF
EELLQAVEVFGFYLATIDMRQDSSVHETCVAELLKSANIVDNYSELTEVEKVAVLLKELQ
EDPRTLSSTNVPKSEILEKELAIFRTARLLKDYIGEDVIKQHIISHTESVSDMFELAILL
KEVGLVDTERARVQIVPLFETIEDLENSNDIMKQYLGYDIVKRWIKNSNNYQEIMLGYSD
SNKDGGYLSSGWTLYKAQNELTKIGEERGIKITFFHGRGGTVGRGGGPSYDAITSQPFGT
IKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAALDRMVTRQIADPDELVDFREIMDGI
VNDSNVIYRDLVFGNEHFYDYFFEASPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFS
WSQNRIMFPGWYGVGSAFNRFIQAEEGNLEKLQHMFETWPFFRSLLSNVDMVLSKSDMNI
AFHYAQLAESEEVRSVFNIILDEWQLTKDVILAIEKHDGFLDESPSLKASLDFRLPYFNV
LNYIQIELIKRLRNNDLTDDEISLIHITINGIATGLRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttaacaaattggaaagcagtaacaaccaggaaatcatctctgaagaagttggt
atcttgaaagaattgttggatgatgcaacacgaggcatggctggagagcaaggtctcaca
actatccaacatttggttgaactttatgatgaaggtgactatgtggcccttacacaagcc
atttcagaaatgacaaatgacgatatggtcgttgcatcacgttatttctctttgttacct
cttttgattaatatctctgaagacgtggatttggcttatgaagtcaaccacaagaacaat
attgatgaatcttatctaggtaagttgtctgaaacctttgatgttgtcgctgaaagtgaa
aatgcacgtgacattcttgaacatgtcaatgtcgtgccagtattgacagcccacccaact
caggttcaacgtaaaaccatgcttgaattgactaaccacattcacgaacttctccgtaag
catcgtgatgttaaggctggtcttatcaacaaggataaatggtatgcagatttgcgtcgt
tatgtagaaatcatgatgcaaacagatatcattcgtgagaaaaaacttaaagttaaaaac
gaaatcactaacgttatggagtattacaactcctcattgattaaggcgattacaaactta
tcacatgaattcaaacgtttagcagttgaaaaaggtatcgaacttgacaatccaacacct
attactatgggaatgtggattggtggtgaccgtgacgggaacccatttgtaacagcagaa
actcttaaactttctgccactgtacaaagtgaagttatccttaactactatattgaaaaa
gttgataatctttaccgttcgttctccctctcatcacgcttgactgaggtttcagataca
gtagcagagatggcgaaacattctccagatacatctgtttatcgtgaaaatgaaccttac
cgtcgtgctttcagttacatccagtctaagttgattcagacacttcttttctttaaagaa
ggaaactttagcaaggaaagagttgctaaacgtctttctgaaaatgttcgtctaggctca
gcttcaacgggtgaagtagtagctgattacgtgcaacaacgtctcagccaaagtcttcaa
gctgtctcacaacaaacgactgaattttatgaaacagctgaggatttccatgatgatctt
ttggcaatcaaaaattcacttcttgaaaacgacgatgctgtcttaatttcaggtgatttt
gaagagcttctccaagctgtagaagtctttggtttctatcttgctacaatcgatatgcgt
caggattcaagcgttcatgaaacttgtgtggcagaattgcttaagtctgctaatattgtt
gataactatagtgaattgactgaggttgaaaaggttgcggttcttctcaaagaattgcaa
gaagatcctcgtactttgtcatcaactaatgtgcctaagtcagaaattcttgaaaaagaa
ttggcaatcttccgtacagctcgtcttttgaaagactatatcggtgaagatgtcatcaaa
caacatatcatctctcacactgagagcgtttctgatatgtttgagttggctatccttctt
aaagaagttggcttggttgatacagaacgtgcgcgtgtccaaatcgttccactttttgaa
actatcgaagacttggaaaactctaatgatatcatgaaacaatatcttggttatgatatc
gttaaacgttggatcaagaatagcaacaactaccaagaaatcatgttgggttactcagat
tctaacaaagatggtggttacttgtcttcaggttggacgctttacaaagctcaaaacgaa
ttgactaagattggtgaagagcgtggcattaagattaccttcttccatggccgtggtggt
actgtcggtcgtggtggtggcccatcatacgatgctattacgtctcaaccatttggtacc
attaaagaccgtattcgtttgactgaacaaggtgaagttatcggtaataaatatggtaat
aaggatgctgcctactacaatcttgaaatgcttgtttcagctgcccttgaccgtatggta
acacgtcaaattgcggacccagatgaattggttgatttccgtgaaattatggacggtatt
gttaatgattctaatgttatctatcgtgatcttgtctttggaaacgaacatttctatgat
tacttctttgaagcaagccctattaaagaagtgtcaagcttgaatatcggttctcgtcca
gcagctcgtaagactattactgagatttctggtcttcgtgcgattccttgggtattctca
tggtcacaaaaccgtatcatgttcccaggttggtatggtgtgggttctgcctttaatcgc
tttatccaagctgaagaaggcaaccttgagaaacttcaacatatgtttgaaacatggcca
ttcttccgttcacttttgtcaaacgtggacatggtgctttcaaaatcagacatgaatatc
gccttccactatgcacaattggcagagagtgaagaagtacgtagtgtcttcaatattatt
ttggatgagtggcagttgactaaggatgttattcttgctattgaaaaacatgatggcttc
cttgatgaaagtccatcgcttaaagcaagtttggacttccgtttgccatacttcaatgtc
ttgaactacatccaaattgaattgattaaacgtcttcgtaacaatgatttgaccgatgac
gaaattagccttattcacattaccatcaatggtattgcaacaggtcttcgtaactctggt
taa

DBGET integrated database retrieval system