KEGG   Streptomyces sp. S10(2016): A4E84_24490Help
Entry
A4E84_24490       CDS       T04777                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
stsi  Streptomyces sp. S10(2016)
Pathway
stsi00473  D-Alanine metabolism
stsi01100  Metabolic pathways
stsi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stsi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4E84_24490
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A4E84_24490
Enzymes [BR:stsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A4E84_24490
Peptidoglycan biosynthesis and degradation proteins [BR:stsi01011]
 Precursor biosynthesis
  Racemase
   A4E84_24490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMW15477
UniProt: A0A143CDF2
LinkDB All DBs
Position
5476762..5477928
Genome map
AA seq 388 aa AA seqDB search
MSERTAPTAPLRARAEIDLAALRANVRALRAHAPGAAVMAVVKSEAYGHGAVPCARAAVA
AGASWLGTATPEEALALRAAGLPGRIMCWLWTPGGPWREAIEADLDVSVSGMWALAEAVG
AARGADRPARVQLKADTGLGRGGCQPGADWAGLVREALRAEAEGLLRVTGLWSHFACADE
PGHPSIADQLGVFREMVAYAEGQGVRPEVRHIANSPATLTLPESHFDLVRTGIATYGISP
SPELGTPADFGLRPVMTLSGSLALVKHVPGGHGVSYGHRYVTPGATTLGLVPLGYADGIP
RHASSAGPVLVEGKWRTIAGRVAMDQFVVDLGGDEPAAGAEAVLFGPGDRGEPTAEDWAQ
AAGTIAYEIVTRIGTRVPRVYVNEERDG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagaacagccccgaccgcgcccctgcgggcccgtgcggagatcgacctggcc
gccctgcgggccaatgtgcgggccctgcgcgcccatgcgccgggcgcggccgtgatggcc
gtggtcaagtccgaggcgtacggccacggggctgtgccgtgcgcccgcgcggccgtcgcc
gcgggggcgagctggctgggcacggccacgcccgaggaggccctggccctgcgggccgcc
gggctgccgggccgcatcatgtgctggctgtggacgcccggcgggccctggcgcgaggcg
atcgaggccgacctggacgtgtccgtcagcgggatgtgggccctggcggaggccgtcggg
gcggccaggggagccgaccggcccgcccgcgtgcagctcaaggccgacaccggcctcggg
cggggcggctgccagcccggggcggactgggccggactggtccgcgaggcgctgcgggcc
gaagccgaggggctcctgcgcgtcacgggactgtggtcgcacttcgcctgcgccgacgag
cccgggcatccctccatcgccgaccagctcggcgtgttccgggagatggtcgcgtacgcc
gagggacagggcgtacggcccgaggtccggcacatcgccaactcgccggccaccctcacg
ctccccgagagccacttcgacctggtccgcaccggcatcgccacctacggcatctcgccc
agccccgagctgggcaccccagccgacttcgggctgcgcccggtgatgacgctgtccggc
tcgctggccctggtcaaacacgtgccgggtgggcacggcgtcagctacggccaccggtac
gtgacacccggcgcgaccaccctcggcctggtgccgctgggctacgccgacggcatcccg
cggcacgcctcctcggccgggccggtcctggtcgagggcaagtggcgcacgatcgccggg
cgggtcgccatggaccagttcgtggtggatctgggcggcgacgagcccgcggccggggcc
gaggcggtcctgttcgggcccggggaccgcggagagcccacggcggaggactgggcccag
gcggccggaaccatcgcctacgagatcgtgacccggatcggaacgcgggttcctcgcgtc
tatgtgaatgaggaacgggacgggtaa

DBGET integrated database retrieval system